Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TMPRSS2 recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O15393
Molecular weight:
44.19 kDa

$500.00

100ug + 500 loyalty points
-Fc Trp106–Arg255
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human TMPRSS2 recombinant protein

Product name Human TMPRSS2 recombinant protein
Uniprot ID O15393
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSR
Molecular weight 44.19 kDa
Protein delivered with Tag? N-Terminal -Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Trp106-Arg255
Aliases /Synonyms Serine protease 10, PRSS10, TMPRSS2, Transmembrane protease serine 2
Reference PX-P6247
Note For research use only
Molecular Constructor
-Fc Trp106–Arg255

Human TMPRSS2 recombinant protein

There are no reviews yet.

Be the first to review “Human TMPRSS2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products