Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Human UHRF1(290-660) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q96T88
Molecular weight:
42,63 kDa

$250.00

+ 250 loyalty points
Partial Yes
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human UHRF1(290-660) Recombinant Protein

Product name Human UHRF1(290-660) Recombinant Protein
Uniprot ID Q96T88
Uniprot link http://www.uniprot.org/uniprot/Q96T88
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEW YCPECRNDASEVVLAGERLRESKKNAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSE SGVHRPHVAGIHGRSNDGSYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPIND QEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRI KKLGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
Molecular weight 42,63 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer NaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAF28469.1
Spec:Entrez GeneID 29128
Spec:NCBI Gene Aliases hUHRF1, ICBP90, RNF106, Np95, huNp95, hNP95
Spec:SwissProtID Q96T88
NCBI Reference AAF28469.1
Aliases /Synonyms ICBP(290-660), transcription factor ICBP90
Reference PX-P1063
Note For research use only
Molecular Constructor
Partial Yes
Product name Human UHRF1(290-660) Recombinant Protein
Uniprot ID Q96T88
Uniprot link http://www.uniprot.org/uniprot/Q96T88
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEW YCPECRNDASEVVLAGERLRESKKNAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSE SGVHRPHVAGIHGRSNDGSYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPIND QEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRI KKLGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
Molecular weight 42,63 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer NaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAF28469.1
Spec:Entrez GeneID 29128
Spec:NCBI Gene Aliases hUHRF1, ICBP90, RNF106, Np95, huNp95, hNP95
Spec:SwissProtID Q96T88
NCBI Reference AAF28469.1
Aliases /Synonyms ICBP(290-660), transcription factor ICBP90
Reference PX-P1063
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human UHRF1(290-660) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products