Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human UHRF1(400-660) tagged Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q96T88
Molecular weight:
30,19 kDa

Original price was: $1,106.00.Current price is: $978.00.

100ug 12% OFF + 978 loyalty points
Partial Yes
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human UHRF1(400-660) tagged Recombinant Protein

Product name Human UHRF1(400-660) tagged Recombinant Protein
Uniprot ID Q96T88
Uniprot link http://www.uniprot.org/uniprot/Q96T88
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDD VDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAP AEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREE EEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
Molecular weight 30,19 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer 100mM Na2HPO4, TrisHCl 10mM, Urea 8M in denaturing conditions. PBS if renaturation.
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAF28469.1
Spec:Entrez GeneID 29128
Spec:NCBI Gene Aliases hUHRF1, ICBP90, RNF106, Np95, huNp95, hNP95
Spec:SwissProtID Q96T88
NCBI Reference AAF28469.1
Aliases /Synonyms ICBP[400-660], transcription factor ICBP90
Reference PX-P2053
Note For research use only
Molecular Constructor
Partial Yes
Product name Human UHRF1(400-660) tagged Recombinant Protein
Uniprot ID Q96T88
Uniprot link http://www.uniprot.org/uniprot/Q96T88
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDD VDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAP AEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREE EEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
Molecular weight 30,19 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer 100mM Na2HPO4, TrisHCl 10mM, Urea 8M in denaturing conditions. PBS if renaturation.
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAF28469.1
Spec:Entrez GeneID 29128
Spec:NCBI Gene Aliases hUHRF1, ICBP90, RNF106, Np95, huNp95, hNP95
Spec:SwissProtID Q96T88
NCBI Reference AAF28469.1
Aliases /Synonyms ICBP[400-660], transcription factor ICBP90
Reference PX-P2053
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P2053-1MG
Uniprot ID Q96T88
Uniprot link http://www.uniprot.org/uniprot/Q96T88
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDD VDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAP AEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREE EEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
Molecular weight 30,19 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer 100mM Na2HPO4, TrisHCl 10mM, Urea 8M in denaturing conditions. PBS if renaturation.
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAF28469.1
Spec:Entrez GeneID 29128
Spec:NCBI Gene Aliases hUHRF1, ICBP90, RNF106, Np95, huNp95, hNP95
Spec:SwissProtID Q96T88
NCBI Reference AAF28469.1
Aliases /Synonyms ICBP[400-660], transcription factor ICBP90
Reference PX-P2053
Note For research use only
Molecular Constructor
Partial Yes

Human UHRF1(400-660) tagged Recombinant Protein

There are no reviews yet.

Be the first to review “Human UHRF1(400-660) tagged Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products