Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human VEGFR2 Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P35968

Original price was: $339.00.Current price is: $271.00.

50ug 20% OFF + 271 loyalty points

Recombinant Human VEGF Protein for VEGF Signaling Studies

Recombinant VEGF protein designed for VEGF pathway and endothelial cell research. Suitable for a wide range of laboratory applications.

Met1–Lys327 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human VEGFR2 Protein, C-Fc

Product name ARO-P18615-100
Uniprot ID P35968
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys327
Aliases /Synonyms Vascular endothelial growth factor receptor 2, VEGFR-2, EC:2.7.10.1, Fetal liver kinase 1, FLK-1, Kinase insert domain receptor, KDR, Protein-tyrosine kinase receptor flk-1, CD309, KDR, FLK1, VEGFR2
Reference ARO-P18615
Note For research use only.
Molecular Constructor
Met1–Lys327 Fc
Product name ARO-P18615-1MG
Uniprot ID P35968
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys327
Aliases /Synonyms Vascular endothelial growth factor receptor 2, VEGFR-2, EC:2.7.10.1, Fetal liver kinase 1, FLK-1, Kinase insert domain receptor, KDR, Protein-tyrosine kinase receptor flk-1, CD309, KDR, FLK1, VEGFR2
Reference ARO-P18615
Note For research use only.
Molecular Constructor
Met1–Lys327 Fc
Product name ARO-P18615-50
Uniprot ID P35968
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEK
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys327
Aliases /Synonyms Vascular endothelial growth factor receptor 2, VEGFR-2, EC:2.7.10.1, Fetal liver kinase 1, FLK-1, Kinase insert domain receptor, KDR, Protein-tyrosine kinase receptor flk-1, CD309, KDR, FLK1, VEGFR2
Reference ARO-P18615
Note For research use only.
Molecular Constructor
Met1–Lys327 Fc

What is recombinant VEGF protein?

Recombinant human VEGF protein is a signaling molecule involved in vascular biology and cellular communication processes. It is commonly used in research to study VEGF-mediated pathways and endothelial cell responses.

Biological role of VEGF

VEGF interacts with specific receptors on endothelial cells and contributes to the regulation of cell growth and vascular-related mechanisms. Recombinant VEGF protein is widely used in laboratory studies to investigate these signaling pathways.

Applications

  • VEGF signaling pathway studies
  • Endothelial cell research
  • Cell culture experiments
  • Protein interaction studies
  • General vascular biology research

Key features

  • Recombinant human VEGF protein
  • Suitable for research applications
  • Consistent quality and reproducibility
  • Designed for laboratory use

Need a specific VEGF protein?

If your research requires a particular format, expression system, or modification, custom recombinant protein development solutions can support your experimental needs.

There are no reviews yet.

Be the first to review “Recombinant Human VEGFR2 Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products