Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human IL11 Antibody (X203)

  • ARO-A12969-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Host species:
Mouse

Original price was: $390.00.Current price is: $305.00.

50ug 22% OFF + 305 loyalty points

Anti Human IL11 Antibody for In Vivo Research

This anti human IL11 antibody (InVivoMAb X203) is designed for in vivo applications and functional studies involving interleukin-11 (IL11). It enables reliable targeting and modulation of IL11 signaling pathways in preclinical research models.

Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human IL11 Antibody (X203)

Product name ARO-A12969-100
Uniprot ID P20809
Raw Antigen Sequence MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IL-11, Interleukin-11, Adipogenesis inhibitory factor, AGIF, Oprelvekin, IL11
Reference ARO-A12969
Clonality Monoclonal Antibody
Protein Name IL-11
Product name ARO-A12969-1MG
Uniprot ID P20809
Raw Antigen Sequence MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IL-11, Interleukin-11, Adipogenesis inhibitory factor, AGIF, Oprelvekin, IL11
Reference ARO-A12969
Clonality Monoclonal Antibody
Protein Name IL-11
Product name ARO-A12969-50
Uniprot ID P20809
Raw Antigen Sequence MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-IL-11, Interleukin-11, Adipogenesis inhibitory factor, AGIF, Oprelvekin, IL11
Reference ARO-A12969
Clonality Monoclonal Antibody
Protein Name IL-11

About IL11 and its role

Interleukin-11 (IL11) is a cytokine involved in multiple biological processes, including immune regulation, fibrosis, and tissue remodeling. Dysregulation of IL11 signaling has been associated with various pathological conditions, making it a key target in therapeutic research.

This antibody allows researchers to investigate IL11-mediated pathways with high specificity and reproducibility.

Applications

  • In vivo functional studies
  • Cytokine signaling research
  • Inflammation and fibrosis models
  • Target validation studies

This antibody is optimized for research applications requiring high specificity and reproducibility.

Key features and benefits

  • Optimized for in vivo use in preclinical models
  • High specificity for human IL11
  • Consistent performance across experimental conditions
  • Research-grade quality for reproducible results

IL11 signaling and receptor interaction

IL11 exerts its biological effects through binding to its receptor IL11RA, activating downstream signaling pathways involved in cell proliferation and inflammation.

Quality and reliability

All ProteoGenix antibodies are produced under strict quality control standards to ensure batch-to-batch consistency and high reproducibility. This guarantees reliable performance in demanding research applications.

Need a tailored antibody solution?

If your research requires specific antibody formats or optimization, custom antibody development solutions can support complex experimental needs beyond off-the-shelf products.

Compare IL11 Research Tools

Product Type Application Best Use Case

InVivoMAb Anti-Human IL11 Antibody (X203)
In vivo antibody Functional studies In vivo IL11 pathway modulation

Anti-Human IL11 Antibody (SAA0379)
Polyclonal antibody Detection assays Sensitive IL11 detection

Anti-Human IL11RA Monoclonal Antibody (X209)
Monoclonal antibody Receptor targeting IL11RA pathway studies

Human IL11RA Recombinant Protein
Recombinant protein Functional assays Receptor interaction studies

InVivoMAb Anti-Human IL11 Antibody (X203) binds to Human IL11 Recombinant Protein, N-GST & C-His in ELISA Assay

InVivoMAb Anti-Human IL11 Antibody (X203) binds to Human IL11 Recombinant Protein, N-GST & C-His in ELISA Assay

Human IL11 Recombinant Protein, N-GST & C-His(cat. No.ARO-P18107) at 0.5µg/mL (100µL/well) can bind InVivoMAb Anti-Human IL11 Antibody (X203) in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for InVivoMAb Anti-Human IL11 Antibody (X203)

SDS-PAGE for InVivoMAb Anti-Human IL11 Antibody (X203)

InVivoMAb Anti-Human IL11 Antibody (X203), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human IL11 Antibody (X203)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products