Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human RSPO3 Antibody (Iv0181)

  • ARO-A13134-50
  • Validated FC
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: $424.00.Current price is: $305.00.

50ug 28% OFF + 305 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human RSPO3 Antibody (Iv0181)

Product name ARO-A13134-100
Uniprot ID Q9BXY4
Raw Antigen Sequence MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-RSPO3, hPWTSR, hRspo3, PWTSR, R-spondin-3, Thrombospondin type-1 domain-containing protein 2, Protein with TSP type-1 repeat, Roof plate-specific spondin-3, THSD2
Reference ARO-A13134
Clonality Monoclonal Antibody
Protein Name RSPO3
Product name ARO-A13134-1MG
Uniprot ID Q9BXY4
Raw Antigen Sequence MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-RSPO3, hPWTSR, hRspo3, PWTSR, R-spondin-3, Thrombospondin type-1 domain-containing protein 2, Protein with TSP type-1 repeat, Roof plate-specific spondin-3, THSD2
Reference ARO-A13134
Clonality Monoclonal Antibody
Protein Name RSPO3
Product name ARO-A13134-50
Uniprot ID Q9BXY4
Raw Antigen Sequence MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-RSPO3, hPWTSR, hRspo3, PWTSR, R-spondin-3, Thrombospondin type-1 domain-containing protein 2, Protein with TSP type-1 repeat, Roof plate-specific spondin-3, THSD2
Reference ARO-A13134
Clonality Monoclonal Antibody
Protein Name RSPO3

SDS-PAGE for InVivoMAb Anti-Human RSPO3 Antibody (Iv0181)

SDS-PAGE for InVivoMAb Anti-Human RSPO3 Antibody (Iv0181)

InVivoMAb Anti-Human RSPO3 Antibody (Iv0181), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for InVivoMAb Anti-Human RSPO3 Antibody (Iv0181)

Flow Cytometry results for InVivoMAb Anti-Human RSPO3 Antibody (Iv0181)

Target Cells were stained with an irrelevant antibody or InVivoMAb Anti-Human RSPO3 Antibody (Iv0181) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human RSPO3 Antibody (Iv0181)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products