Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rosmantuzumab Biosimilar – Anti-RSPO3 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $221.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade

Product name Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade
Uniprot ID Q9BXY4
Source CAS 1684393-04-1
Species Humanized
Raw Antigen Sequence MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Rosmantuzumab,OMP-131R10,RSPO3,anti-RSPO3
Reference PX-TA1446
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade
Uniprot ID Q9BXY4
Source CAS 1684393-04-1
Species Humanized
Raw Antigen Sequence MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Rosmantuzumab,OMP-131R10,RSPO3,anti-RSPO3
Reference PX-TA1446
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1446-50
Uniprot ID Q9BXY4
Source CAS 1684393-04-1
Species Humanized
Raw Antigen Sequence MHLRLISWLFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Rosmantuzumab,OMP-131R10,RSPO3,anti-RSPO3
Reference PX-TA1446
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Rosmantuzumab Biosimilar, also known as Anti-RSPO3 mAb, is a research grade antibody that has shown promising results in targeting and inhibiting the activity of RSPO3, a protein involved in the Wnt signaling pathway. This pathway plays a crucial role in cell proliferation and differentiation, and dysregulation of the pathway has been linked to various diseases, including cancer. In this article, we will explore the structure, activity, and potential applications of Rosmantuzumab Biosimilar as a therapeutic target.

Structure of Rosmantuzumab Biosimilar

Rosmantuzumab Biosimilar is a monoclonal antibody, meaning it is produced by a single type of immune cell and has a highly specific binding affinity for its target. It is a recombinant protein, meaning it is produced through genetic engineering techniques. The antibody is composed of two heavy chains and two light chains, each with a specific amino acid sequence that determines its structure and function.

The variable regions of the antibody, also known as the antigen-binding regions, are responsible for recognizing and binding to the target molecule, RSPO3. These regions are highly specific and allow the antibody to bind to RSPO3 with high affinity and specificity.

The constant regions of the antibody, on the other hand, are responsible for the effector functions of the antibody, such as activating the immune system to attack and destroy the target molecule. These regions are also important for the stability and half-life of the antibody in the body.

Activity of Rosmantuzumab Biosimilar

Rosmantuzumab Biosimilar works by binding to RSPO3 and preventing it from activating the Wnt signaling pathway. This inhibits the proliferation and survival of cancer cells that rely on this pathway for growth and survival. In addition, the antibody can also induce antibody-dependent cellular cytotoxicity (ADCC), where immune cells are activated to attack and destroy the RSPO3-expressing cells.

Studies have shown that Rosmantuzumab Biosimilar has a high binding affinity for RSPO3 and can effectively inhibit its activity. It has also been found to be well-tolerated and safe in preclinical studies, with minimal side effects.

Potential Applications of Rosmantuzumab Biosimilar

As a therapeutic target, Rosmantuzumab Biosimilar has potential applications in various diseases, particularly in cancers that are driven by the Wnt signaling pathway. This includes colorectal cancer, gastric cancer, and hepatocellular carcinoma, among others.

Currently, Rosmantuzumab Biosimilar is being evaluated in clinical trials as a potential treatment for advanced solid tumors. Early results have shown promising anti-tumor activity, with some patients experiencing partial or complete responses to the treatment.

In addition to its potential as a cancer treatment, Rosmantuzumab Biosimilar may also have applications in other diseases where the Wnt signaling pathway is dysregulated, such as osteoporosis and fibrosis. Further research and clinical trials are needed to fully explore the potential of this antibody in these areas.

Conclusion

Rosmantuzumab Biosimilar is a research grade antibody that has shown promising results in targeting and inhibiting RSPO3, a protein involved in the Wnt signaling pathway. Its specific structure and high binding affinity make it a promising therapeutic target for various diseases, particularly cancers driven by the Wnt pathway. With ongoing research and clinical trials, Rosmantuzumab Biosimilar has the potential to become an effective treatment option for patients in need.

SDS-PAGE for Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade

SDS-PAGE for Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade

Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Rosmantuzumab Biosimilar - Anti-RSPO3 mAb - Research Grade

  • Eline J. ter Steege, Loes W. Doornbos, Peter D. Haughton, Paul J. van Diest, John Hilkens, Patrick W.B. Derksen, Elvira R.M. Bakker, R-spondin-3 promotes proliferation and invasion of breast cancer cells independently of Wnt signaling, Cancer Letters, Volume 568, 2023, 216301, ISSN 0304-3835, https://doi.org/10.1016/j.canlet.2023.216301.
  • Sugimoto, A., Saito, Y., Wang, G. et al. Hepatic stellate cells control liver zonation, size and functions via R-spondin 3. Nature (2025). https://doi.org/10.1038/s41586-025-08677-w

There are no reviews yet.

Be the first to review “Rosmantuzumab Biosimilar – Anti-RSPO3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products