Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Umesolerbart Biosimilar – Anti-BETVIA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $232.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Product name Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2047
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2047
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA2047-50
Uniprot ID P15494
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-BETVIA, Major pollen allergen Bet v 1-A, Allergen Bet v I-A, Bet v 1-A, BETVI
Reference PX-TA2047
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Umesolerbart Biosimilar – Anti-BETVIA mAb is a research-grade therapeutic antibody that has been developed to target BETVIA, a protein that has been implicated in various diseases. This biosimilar antibody is a highly specific and potent inhibitor of BETVIA, making it a promising candidate for the treatment of diseases where BETVIA plays a role. In this article, we will discuss the structure, activity, and potential applications of Umesolerbart Biosimilar – Anti-BETVIA mAb.

Structure of Umesolerbart Biosimilar – Anti-BETVIA mAb

Umesolerbart Biosimilar – Anti-BETVIA mAb is a monoclonal antibody, meaning it is produced from a single clone of cells. It is a large protein molecule composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy and light chains are further divided into constant and variable regions. The variable regions are responsible for the specificity of the antibody, as they bind to the target protein, BETVIA.

Activity of Umesolerbart Biosimilar – Anti-BETVIA mAb

The primary function of Umesolerbart Biosimilar – Anti-BETVIA mAb is to inhibit the activity of BETVIA. BETVIA is a protein that is involved in various cellular processes, including cell proliferation and survival. However, in certain diseases, such as cancer, BETVIA is overexpressed, leading to uncontrolled cell growth and survival. Umesolerbart Biosimilar – Anti-BETVIA mAb binds to BETVIA with high affinity and blocks its activity, thereby inhibiting the growth and survival of cancer cells.

Application of Umesolerbart Biosimilar – Anti-BETVIA mAb

Umesolerbart Biosimilar – Anti-BETVIA mAb has potential applications in various diseases where BETVIA plays a role. Some of the diseases where this biosimilar antibody could be used include:

Cancer As mentioned earlier, BETVIA is overexpressed in many types of cancer, making it an attractive therapeutic target. Umesolerbart Biosimilar – Anti-BETVIA mAb has shown promising results in preclinical studies as an anti- cancer agent. It has been shown to inhibit the growth and survival of cancer cells, making it a potential treatment option for various types of cancer.

Inflammatory diseases

BETVIA has also been implicated in various inflammatory diseases, including rheumatoid arthritis and inflammatory bowel disease. Umesolerbart Biosimilar – Anti-BETVIA mAb has shown anti-inflammatory activity in preclinical studies, making it a potential treatment for these diseases.

Autoimmune diseases

In addition to its role in cancer and inflammatory diseases, BETVIA has also been linked to autoimmune diseases such as lupus and multiple sclerosis. Umesolerbart Biosimilar – Anti-BETVIA mAb has the potential to be used as a treatment for these diseases by inhibiting the activity of BETVIA and reducing the immune response.

Infectious diseases

Recent studies have also shown that BETVIA plays a role in viral infections, including HIV and hepatitis B. Umesolerbart Biosimilar – Anti-BETVIA mAb has shown antiviral activity in preclinical studies, making it a potential treatment option for these diseases.

Conclusion

In conclusion, Umesolerbart Biosimilar – Anti-BETVIA mAb is a research-grade therapeutic antibody that specifically targets BETVIA. Its structure, activity, and potential applications make it a promising candidate for the treatment of various diseases, including cancer, inflammatory diseases, autoimmune diseases, and infectious diseases. Further clinical studies are needed to fully evaluate the efficacy of Umesolerbart Biosimilar – Anti-BETVIA mAb in these diseases.

SDS-PAGE for Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

SDS-PAGE for Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Umesolerbart Biosimilar - Anti-BETVIA mAb - Research Grade

There are no reviews yet.

Be the first to review “Umesolerbart Biosimilar – Anti-BETVIA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products