Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Mouse CTLA4 & OX40 Bispecific Antibody (Iv0227)

Clonality:
Monoclonal Antibody
Host species:
Mouse

Original price was: $781.00.Current price is: $565.00.

100ug 28% OFF + 565 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for InVivoMAb Anti-Mouse CTLA4 & OX40 Bispecific Antibody (Iv0227)

InVivoMAb Anti-Mouse CTLA4 & OX40 Bispecific Antibody (Iv0227)

Product name ARO-A12990-100
Uniprot ID P09793 & P47741
Raw Antigen Sequence MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Bispecific, Cytotoxic T-lymphocyte protein 4, Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4, CD152, Ctla4, Cd152, Tumor necrosis factor receptor superfamily member 4, OX40 antigen, OX40L receptor, CD134, Tnfrsf4, Ox40, Txgp1
Reference ARO-A12990
Clonality Monoclonal Antibody
Protein Name Bispecific
Product name ARO-A12990-1MG
Uniprot ID P09793 & P47741
Raw Antigen Sequence MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Bispecific, Cytotoxic T-lymphocyte protein 4, Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4, CD152, Ctla4, Cd152, Tumor necrosis factor receptor superfamily member 4, OX40 antigen, OX40L receptor, CD134, Tnfrsf4, Ox40, Txgp1
Reference ARO-A12990
Clonality Monoclonal Antibody
Protein Name Bispecific
Product name ARO-A12990-50
Uniprot ID P09793 & P47741
Raw Antigen Sequence MACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILVAVSLGLFFYSFLVSAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-Bispecific, Cytotoxic T-lymphocyte protein 4, Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4, CD152, Ctla4, Cd152, Tumor necrosis factor receptor superfamily member 4, OX40 antigen, OX40L receptor, CD134, Tnfrsf4, Ox40, Txgp1
Reference ARO-A12990
Clonality Monoclonal Antibody
Protein Name Bispecific

SDS-PAGE for InVivoMAb Anti-Mouse CTLA4 & OX40 Bispecific Antibody (Iv0227)

SDS-PAGE for InVivoMAb Anti-Mouse CTLA4 & OX40 Bispecific Antibody (Iv0227)

InVivoMAb Anti-Mouse CTLA4 & OX40 Bispecific Antibody (Iv0227), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Mouse CTLA4 & OX40 Bispecific Antibody (Iv0227)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products