Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lenercept Biosimilar – Anti-TNF fusion protein – Research Grade

  • PX-TA2017-50
  • Validated ELISA
Uniprot ID:
P01375

Original price was: $207.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Lenercept Biosimilar - Anti-TNF fusion protein - Research Grade

Product name Lenercept Biosimilar - Anti-TNF fusion protein - Research Grade
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2017
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1A (tumor necrosis factor receptor (TNFR) superfamilly member 1A, TNFAR, TNF-RI, TNF-R-I, p55, CD120a)]2 - IGHG1 Fc (Fragment constant)
Product name Lenercept Biosimilar - Anti-TNF fusion protein - Research Grade
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2017
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1A (tumor necrosis factor receptor (TNFR) superfamilly member 1A, TNFAR, TNF-RI, TNF-R-I, p55, CD120a)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2017-50
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2017
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1A (tumor necrosis factor receptor (TNFR) superfamilly member 1A, TNFAR, TNF-RI, TNF-R-I, p55, CD120a)]2 - IGHG1 Fc (Fragment constant)

Lenercept Biosimilar: An Anti-TNF Fusion Protein for Therapeutic Targeting

Lenercept Biosimilar is a novel anti-tumor necrosis factor (TNF) fusion protein that has been developed as a potential therapeutic agent for various inflammatory and autoimmune diseases. This research grade protein is a biosimilar of the well-known anti-TNF drug, etanercept, and has shown promising results in pre-clinical studies. In this article, we will discuss the structure, activity, and potential applications of Lenercept Biosimilar in detail.

Structure of Lenercept Biosimilar

Lenercept Biosimilar is a fusion protein composed of two components – a human TNF receptor 2 (TNFR2) and the Fc fragment of human immunoglobulin G1 (IgG1). The TNFR2 component of Lenercept Biosimilar is responsible for binding to TNF, while the Fc fragment provides stability and prolongs the half-life of the protein in the body. The TNFR2 component consists of 277 amino acids and is attached to the Fc fragment through a flexible linker region. The overall molecular weight of Lenercept Biosimilar is approximately 150 kDa.

The structure of Lenercept Biosimilar is designed to mimic the structure and function of the natural TNF receptor. This allows for effective binding and neutralization of TNF, which is a key mediator of inflammation and immune response. The Fc fragment also plays a crucial role in the activity of Lenercept Biosimilar by enhancing its binding to TNF and promoting its clearance from the body.

Activity of Lenercept Biosimilar

The primary activity of Lenercept Biosimilar is the inhibition of TNF, a pro-inflammatory cytokine that is involved in various pathological conditions. TNF is produced by immune cells in response to infection, injury, or other triggers and plays a critical role in initiating and maintaining inflammation. In chronic inflammatory and autoimmune diseases, such as rheumatoid arthritis, psoriasis, and Crohn’s disease, TNF levels are significantly elevated, leading to tissue damage and disease progression.

Lenercept Biosimilar works by binding to TNF and preventing it from interacting with its receptors on immune cells. This blocks the downstream signaling pathways that lead to inflammation and tissue damage. By inhibiting TNF, Lenercept Biosimilar can effectively reduce the symptoms and progression of inflammatory and autoimmune diseases.

Applications of Lenercept Biosimilar

The potential applications of Lenercept Biosimilar are vast, given the central role of TNF in various diseases. It is currently being investigated as a potential treatment for rheumatoid arthritis, psoriasis, psoriatic arthritis, ankylosing spondylitis, and inflammatory bowel disease. In pre-clinical studies, Lenercept Biosimilar has shown comparable efficacy and safety to etanercept, the reference anti-TNF drug.

In addition to its therapeutic applications, Lenercept Biosimilar can also be used as a research tool for studying the role of TNF in various diseases. Its specificity and potency make it a valuable tool for investigating the mechanism of action of TNF and its potential as a therapeutic target.

Conclusion

Lenercept Biosimilar is a promising anti-TNF fusion protein that has the potential to revolutionize the treatment of inflammatory and autoimmune diseases. Its unique structure, activity, and potential applications make it a valuable addition to the arsenal of biologics targeting TNF. Further clinical trials are needed to establish its safety and efficacy in patients, but the pre-clinical data is highly encouraging. With the increasing prevalence of TNF-driven diseases, Lenercept Biosimilar has the potential to make a significant impact on patient outcomes and improve their quality of life.

SDS-PAGE for Research Grade Lenercept

SDS-PAGE for Research Grade Lenercept

Research Grade Lenercept, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Research Grade Lenercept in ELISA Assay

Research Grade Lenercept in ELISA Assay

Research Grade Lenercept can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Lenercept Biosimilar - Anti-TNF fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Lenercept Biosimilar – Anti-TNF fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products