Skip to main content
Contact +1 (919) 234-1277

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Lmo0161 protein(lmo0161)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q8YAG5
Molecular weight:
32.71kDa

$250.00

+ 250 loyalty points
full length
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Lmo0161 protein(lmo0161)

Lmo0161 protein(lmo0161)

Product name Lmo0161 protein(lmo0161)
Uniprot ID Q8YAG5
Uniprot link http://www.uniprot.org/uniprot/Q8YAG5
Expression system Prokaryotic expression
Sequence MGNESNGSMELYLREHTEEIINNWLSKIYENTYTSFVYSPQYKDELRADSEQTADLIISYFAGKKAFFEKLDKWLDNMYA RRMENEVPLPEVITTLDKLRREFVTAVGDFCIHNDEVSKCEFSSSMAMVNHGFDRINEAFSAMYYNDIVKHLEQQHRLIE EISTPVISITDKLAILPLMGRVDRERAEKLSEITANKCVHLGVEQLCIDLSGITYFDDALGEMLTNLVTMLKLLGVEAFI SGIQPKMAQQINRVDLNLSIPAYHSLKAVLQDQTRTIGSHHHHHH
Molecular weight 32.71kDa
Purity estimated 80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4540
Note For research use only
Molecular Constructor
full length
Product name Lmo0161 protein(lmo0161)
Uniprot ID Q8YAG5
Uniprot link http://www.uniprot.org/uniprot/Q8YAG5
Expression system Prokaryotic expression
Sequence MGNESNGSMELYLREHTEEIINNWLSKIYENTYTSFVYSPQYKDELRADSEQTADLIISYFAGKKAFFEKLDKWLDNMYA RRMENEVPLPEVITTLDKLRREFVTAVGDFCIHNDEVSKCEFSSSMAMVNHGFDRINEAFSAMYYNDIVKHLEQQHRLIE EISTPVISITDKLAILPLMGRVDRERAEKLSEITANKCVHLGVEQLCIDLSGITYFDDALGEMLTNLVTMLKLLGVEAFI SGIQPKMAQQINRVDLNLSIPAYHSLKAVLQDQTRTIGSHHHHHH
Molecular weight 32.71kDa
Purity estimated 80% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4540
Note For research use only
Molecular Constructor
full length

There are no reviews yet.

Be the first to review “Lmo0161 protein(lmo0161)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products