Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

RsbS protein(rsbS)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q92DC5
Molecular weight:
13.53kDa

Original price was: $293.00.Current price is: $250.00.

50ug 15% OFF + 250 loyalty points
full length
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

RsbS protein(rsbS)

Product name RsbS protein(rsbS)
Uniprot ID Q92DC5
Uniprot link http://www.uniprot.org/uniprot/Q92DC5
Expression system Prokaryotic expression
Raw Antigen Sequence MGIPILKLGECLLISIQSELDDHTAVEFQEDLLAKIHETSARGVVIDITSIDFIDSFIAKILGDVVSMSKLMGAKVVVTGIQPAVAITLIELGITFSGVLSAMDLESGLEKLKQELGE
Molecular weight 13.53kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4544
Note For research use only
Molecular Constructor
full length
Product name RsbS protein(rsbS)
Uniprot ID Q92DC5
Uniprot link http://www.uniprot.org/uniprot/Q92DC5
Expression system Prokaryotic expression
Raw Antigen Sequence MGIPILKLGECLLISIQSELDDHTAVEFQEDLLAKIHETSARGVVIDITSIDFIDSFIAKILGDVVSMSKLMGAKVVVTGIQPAVAITLIELGITFSGVLSAMDLESGLEKLKQELGE
Molecular weight 13.53kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4544
Note For research use only
Molecular Constructor
full length
Product name PX-P4544-1MG
Uniprot ID Q92DC5
Uniprot link http://www.uniprot.org/uniprot/Q92DC5
Expression system Prokaryotic expression
Raw Antigen Sequence MGIPILKLGECLLISIQSELDDHTAVEFQEDLLAKIHETSARGVVIDITSIDFIDSFIAKILGDVVSMSKLMGAKVVVTGIQPAVAITLIELGITFSGVLSAMDLESGLEKLKQELGE
Molecular weight 13.53kDa
Purity estimated 90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type full length
Reference PX-P4544
Note For research use only
Molecular Constructor
full length

RsbS protein(rsbS)

There are no reviews yet.

Be the first to review “RsbS protein(rsbS)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products