Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant DENV-2 Protein prM/prM Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Dengue virus type 2 (strain Jamaica/1409/1983) (DENV-2)
Uniprot ID:
P07564
Molecular weight:
37.74 kDa

Original price was: $337.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Gly122–Arg205
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant DENV-2 Protein prM/prM Protein, N-GST & C-His

Recombinant DENV-2 Protein prM/prM Protein, N-GST & C-His

Product name ARO-P10880-100
Uniprot ID P07564
Origin species Dengue virus type 2 (strain Jamaica/1409/1983) (DENV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence GEPHMIVGRQEKGKSLLFKTEDGVNMCTLMAIDLGELCEDTITYKCPLLRQNEPEDIDCWCNSTSTWVTYGTCATTGEHRREKR
Molecular weight 37.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly122-Arg205
Aliases /Synonyms Genome polyprotein, Protein prM, Precursor membrane protein, Dengue virus type 2 (strain Jamaica/1409/1983) (DENV-2)
Reference ARO-P10880
Note For research use only.
Molecular Constructor
Gly122–Arg205
Product name ARO-P10880-1MG
Uniprot ID P07564
Origin species Dengue virus type 2 (strain Jamaica/1409/1983) (DENV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence GEPHMIVGRQEKGKSLLFKTEDGVNMCTLMAIDLGELCEDTITYKCPLLRQNEPEDIDCWCNSTSTWVTYGTCATTGEHRREKR
Molecular weight 37.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly122-Arg205
Aliases /Synonyms Genome polyprotein, Protein prM, Precursor membrane protein, Dengue virus type 2 (strain Jamaica/1409/1983) (DENV-2)
Reference ARO-P10880
Note For research use only.
Molecular Constructor
Gly122–Arg205
Product name ARO-P10880-50
Uniprot ID P07564
Origin species Dengue virus type 2 (strain Jamaica/1409/1983) (DENV-2)
Expression system Prokaryotic expression
Raw Antigen Sequence GEPHMIVGRQEKGKSLLFKTEDGVNMCTLMAIDLGELCEDTITYKCPLLRQNEPEDIDCWCNSTSTWVTYGTCATTGEHRREKR
Molecular weight 37.74 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly122-Arg205
Aliases /Synonyms Genome polyprotein, Protein prM, Precursor membrane protein, Dengue virus type 2 (strain Jamaica/1409/1983) (DENV-2)
Reference ARO-P10880
Note For research use only.
Molecular Constructor
Gly122–Arg205

Recombinant DENV-2 Protein prM/prM Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant DENV-2 Protein prM/prM Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products