Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SNRPN Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P63162
Molecular weight:
21.98 kDa

Original price was: $343.00.Current price is: $274.00.

50ug 20% OFF + 274 loyalty points
Thr2–Gly84
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SNRPN Protein, N-His-SUMO

Product name ARO-P11924-100
Uniprot ID P63162
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEG
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly84
Aliases /Synonyms SNRPN, HCERN3, Sm-N, Sm-D, SmN, Sm protein D, Small nuclear ribonucleoprotein-associated protein N, snRNP-N, Sm protein N, SMN, Tissue-specific-splicing protein
Reference ARO-P11924
Note For research use only.
Molecular Constructor
Thr2–Gly84
Product name ARO-P11924-1MG
Uniprot ID P63162
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEG
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly84
Aliases /Synonyms SNRPN, HCERN3, Sm-N, Sm-D, SmN, Sm protein D, Small nuclear ribonucleoprotein-associated protein N, snRNP-N, Sm protein N, SMN, Tissue-specific-splicing protein
Reference ARO-P11924
Note For research use only.
Molecular Constructor
Thr2–Gly84
Product name ARO-P11924-50
Uniprot ID P63162
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEG
Molecular weight 21.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr2-Gly84
Aliases /Synonyms SNRPN, HCERN3, Sm-N, Sm-D, SmN, Sm protein D, Small nuclear ribonucleoprotein-associated protein N, snRNP-N, Sm protein N, SMN, Tissue-specific-splicing protein
Reference ARO-P11924
Note For research use only.
Molecular Constructor
Thr2–Gly84

Introduction
Recombinant Human SNRPN Protein, also known as Small Nuclear Ribonucleoprotein Polypeptide N, is a protein that plays a crucial role in the processing and modification of RNA molecules in the cell. This protein is encoded by the SNRPN gene and is essential for the proper functioning of the nervous system. In this article, we will explore the structure, activity, and applications of Recombinant Human SNRPN Protein.

Structure
Recombinant Human SNRPN Protein is a 71 amino acid long polypeptide with a molecular weight of approximately 8 kDa. It is composed of two domains, the N-terminal domain and the C-terminal domain, connected by a flexible linker region. The N-terminal domain contains a coiled-coil structure, which is responsible for protein-protein interactions, while the C-terminal domain contains a glycine-rich region, which is essential for RNA binding.

Activity
Recombinant Human SNRPN Protein is primarily involved in the processing and modification of RNA molecules. It is a component of the small nuclear ribonucleoprotein (snRNP) complex, which is responsible for the splicing of pre-mRNA molecules. This protein binds to specific sequences on the pre-mRNA and facilitates the removal of introns, resulting in the production of mature mRNA. It also plays a role in the modification of RNA molecules by adding a chemical group called a methyl group to specific nucleotides. This modification is essential for the proper functioning of RNA molecules.

Applications
Recombinant Human SNRPN Protein has several applications in the field of molecular biology and biotechnology. It is widely used in research studies to understand the role of this protein in RNA processing and modification. Recombinant SNRPN Protein is also used in the production of monoclonal antibodies for diagnostic and therapeutic purposes. Additionally, this protein is used in the development of gene therapy strategies for genetic disorders that involve mutations in the SNRPN gene.

Recombinant Protein Production
Recombinant Human SNRPN Protein is produced using recombinant DNA technology. The gene encoding this protein is cloned into an expression vector and then introduced into a host cell, such as E. coli or yeast. The host cell then produces large quantities of the protein, which can be purified using various chromatography techniques. The recombinant protein is highly pure and biologically active, making it suitable for various applications.

Antigen Detection
Recombinant Human SNRPN Protein can also be used as an antigen in diagnostic tests for certain neurological disorders. Antibodies against this protein are found in the blood of individuals with certain autoimmune disorders, such as myasthenia gravis. These antibodies can be detected using recombinant SNRPN Protein, providing a reliable and accurate diagnosis for these disorders.

Conclusion
In conclusion, Recombinant Human SNRPN Protein is a vital component in the processing and modification of RNA molecules. Its structure, activity, and applications make it an essential protein in various fields, including molecular biology, biotechnology, and medicine. The production of this protein using recombinant DNA technology has made it readily available for research and diagnostic purposes. Further studies on this protein may uncover its potential for the development of new therapies for genetic disorders and autoimmune diseases.

Recombinant Human SNRPN Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human SNRPN Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products