Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ULBP1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BZM6
Molecular weight:
23.22 kDa

Original price was: $269.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Thr30–Asp206
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ULBP1 Protein, N-His

Product name ARO-P11677-100
Uniprot ID Q9BZM6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence THCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLD
Molecular weight 23.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr30-Asp206
Aliases /Synonyms Retinoic acid early transcript 1I, UL16-binding protein 1, ALCAN-beta, N2DL-1, NKG2DL1, RAET1I, N2DL1, NKG2D ligand 1, ULBP1
Reference ARO-P11677
Note For research use only.
Molecular Constructor
Thr30–Asp206
Product name ARO-P11677-1MG
Uniprot ID Q9BZM6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence THCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLD
Molecular weight 23.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr30-Asp206
Aliases /Synonyms Retinoic acid early transcript 1I, UL16-binding protein 1, ALCAN-beta, N2DL-1, NKG2DL1, RAET1I, N2DL1, NKG2D ligand 1, ULBP1
Reference ARO-P11677
Note For research use only.
Molecular Constructor
Thr30–Asp206
Product name ARO-P11677-50
Uniprot ID Q9BZM6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence THCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLD
Molecular weight 23.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr30-Asp206
Aliases /Synonyms Retinoic acid early transcript 1I, UL16-binding protein 1, ALCAN-beta, N2DL-1, NKG2DL1, RAET1I, N2DL1, NKG2D ligand 1, ULBP1
Reference ARO-P11677
Note For research use only.
Molecular Constructor
Thr30–Asp206

Introduction to Recombinant Human ULBP1 Protein

Recombinant Human ULBP1 Protein, also known as UL16 binding protein 1, is a type I transmembrane glycoprotein that belongs to the family of NKG2D ligands. It is encoded by the ULBP1 gene and is expressed on the surface of various cells, including tumor cells, infected cells, and stressed cells. ULBP1 is involved in immune surveillance and plays a crucial role in the recognition and elimination of abnormal or infected cells by the immune system.

Structure of Recombinant Human ULBP1 Protein

The recombinant form of human ULBP1 protein is a 30 kDa protein consisting of 257 amino acids. It contains a signal peptide, a transmembrane domain, and a cytoplasmic tail. The extracellular region of ULBP1 is composed of two immunoglobulin-like domains, which are responsible for binding to the NKG2D receptor on immune cells. The cytoplasmic tail of ULBP1 contains a conserved sequence that is crucial for intracellular signaling and regulation of protein expression.

Activity of Recombinant Human ULBP1 Protein

Recombinant Human ULBP1 Protein is a potent activator of the immune system. It functions as a ligand for the NKG2D receptor, which is expressed on the surface of natural killer (NK) cells, CD8+ T cells, and γδ T cells. Binding of ULBP1 to NKG2D leads to the activation of immune cells, triggering their cytotoxic activity against target cells. This results in the elimination of infected or abnormal cells, providing protection against viral infections and cancer.

In addition to its role in immune surveillance, recombinant ULBP1 also has immunoregulatory functions. It has been shown to induce the production of cytokines and chemokines, which are essential for the recruitment and activation of immune cells. ULBP1 has also been reported to modulate the activity of dendritic cells, which are crucial for initiating and regulating immune responses.

Application of Recombinant Human ULBP1 Protein

The unique properties of recombinant ULBP1 make it a valuable tool for various research and clinical applications. One of its major applications is in cancer immunotherapy. Many cancer cells express high levels of ULBP1, making them susceptible to recognition and elimination by immune cells. Recombinant ULBP1 can be used to enhance the cancer-killing activity of immune cells, making it a promising candidate for the development of new cancer treatments.

Recombinant ULBP1 also has potential applications in the treatment of viral infections. It has been shown to enhance the antiviral activity of NK cells and CD8+ T cells against various viruses, including HIV and hepatitis B virus. This makes it a promising candidate for the development of new antiviral therapies.

Furthermore, recombinant ULBP1 has been used in research studies to investigate its role in various immune-related diseases, such as autoimmune disorders and transplant rejection. Its ability to activate and regulate immune responses makes it a valuable tool for understanding the mechanisms underlying these diseases and identifying potential therapeutic targets.

Conclusion

In summary, Recombinant Human ULBP1 Protein is a potent immune activator with diverse functions in immune surveillance and regulation. Its structure, activity, and applications make it a valuable tool for research and clinical purposes, particularly in the fields of cancer immunotherapy and antiviral therapy. Further studies on ULBP1 and its interactions with the immune system may lead to the development of novel treatments for various diseases.

Recombinant Human ULBP1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ULBP1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products