Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NABP1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96AH0
Molecular weight:
23.95 kDa

Original price was: $274.00.Current price is: $230.00.

50ug 16% OFF + 230 loyalty points
Asn22–Gly126
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NABP1 Protein, N-His-SUMO

Product name ARO-P11652-100
Uniprot ID Q96AH0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKG
Molecular weight 23.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn22-Gly126
Aliases /Synonyms Nucleic acid-binding protein 1, SOSS complex subunit B2, OBFC2A, Single-stranded DNA-binding protein 2, Sensor of ssDNA subunit B2, hSSB2, SSB2, SOSS-B2, NABP1, Oligonucleotide/oligosaccharide-binding fold-containing protein 2A, Sensor of single-strand DNA complex subunit B2
Reference ARO-P11652
Note For research use only.
Molecular Constructor
Asn22–Gly126
Product name ARO-P11652-1MG
Uniprot ID Q96AH0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKG
Molecular weight 23.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn22-Gly126
Aliases /Synonyms Nucleic acid-binding protein 1, SOSS complex subunit B2, OBFC2A, Single-stranded DNA-binding protein 2, Sensor of ssDNA subunit B2, hSSB2, SSB2, SOSS-B2, NABP1, Oligonucleotide/oligosaccharide-binding fold-containing protein 2A, Sensor of single-strand DNA complex subunit B2
Reference ARO-P11652
Note For research use only.
Molecular Constructor
Asn22–Gly126
Product name ARO-P11652-50
Uniprot ID Q96AH0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKG
Molecular weight 23.95 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn22-Gly126
Aliases /Synonyms Nucleic acid-binding protein 1, SOSS complex subunit B2, OBFC2A, Single-stranded DNA-binding protein 2, Sensor of ssDNA subunit B2, hSSB2, SSB2, SOSS-B2, NABP1, Oligonucleotide/oligosaccharide-binding fold-containing protein 2A, Sensor of single-strand DNA complex subunit B2
Reference ARO-P11652
Note For research use only.
Molecular Constructor
Asn22–Gly126

Recombinant Human NABP1 Protein, also known as Nucleic Acid Binding Protein 1, is a highly conserved protein that plays a crucial role in DNA replication and repair. This protein is encoded by the NABP1 gene and is expressed in various tissues, including the brain, heart, and liver. Recombinant Human NABP1 Protein is commonly used in research and diagnostic applications due to its unique structure and function.

Structure of Recombinant Human NABP1 Protein

Recombinant Human NABP1 Protein is composed of 482 amino acids and has a molecular weight of approximately 54 kDa. It is a homodimer, meaning it is made up of two identical subunits, with each subunit containing three distinct domains. The N-terminal domain is responsible for DNA binding, the central domain is involved in protein-protein interactions, and the C-terminal domain is responsible for dimerization. The structure of Recombinant Human NABP1 Protein is essential for its function in DNA binding and repair.

Activity of Recombinant Human NABP1 Protein

Recombinant Human NABP1 Protein is a key player in maintaining genome stability by binding to damaged DNA and recruiting other proteins involved in DNA repair. It has a high affinity for single-stranded DNA and can also bind to double-stranded DNA. This protein is involved in various DNA repair pathways, including base excision repair, nucleotide excision repair, and mismatch repair. Additionally, Recombinant Human NABP1 Protein has been shown to regulate cell cycle progression and apoptosis, further highlighting its essential role in maintaining genomic integrity.

Application of Recombinant Human NABP1 Protein

Recombinant Human NABP1 Protein has numerous applications in both research and diagnostic settings. Its ability to bind to damaged DNA makes it a valuable tool for studying DNA repair mechanisms and the role of this protein in maintaining genome stability. This protein has also been implicated in various diseases, including cancer, making it a potential therapeutic target.

In diagnostic applications, Recombinant Human NABP1 Protein is used as an antigen in immunoassays for the detection of autoantibodies. Autoantibodies against this protein have been found in patients with autoimmune diseases such as systemic lupus erythematosus and rheumatoid arthritis. By using Recombinant Human NABP1 Protein as an antigen, these autoantibodies can be detected and used as biomarkers for disease diagnosis and monitoring.

Furthermore, Recombinant Human NABP1 Protein has been shown to have potential as a prognostic marker in various cancers. Studies have found that higher levels of this protein are associated with a better prognosis in breast cancer patients, while lower levels are associated with a poorer prognosis in patients with non-small cell lung cancer. This highlights the potential of Recombinant Human NABP1 Protein as a biomarker for cancer prognosis and personalized treatment strategies.

Conclusion

In summary, Recombinant Human NABP1 Protein is a crucial protein involved in DNA repair and maintenance of genomic stability. Its unique structure and function make it a valuable tool in research and diagnostic applications. With its potential as a therapeutic target and biomarker for various diseases, this protein continues to be a subject of interest for scientists and clinicians alike.

Recombinant Human NABP1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human NABP1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products