Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PMP2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P02689
Molecular weight:
17.07 kDa

Original price was: $337.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Met1–Val132
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PMP2 Protein, N-His

Product name ARO-P12276-100
Uniprot ID P02689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Molecular weight 17.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val132
Aliases /Synonyms PMP2, Myelin P2 protein, Peripheral myelin protein 2
Reference ARO-P12276
Note For research use only.
Molecular Constructor
Met1–Val132
Product name ARO-P12276-1MG
Uniprot ID P02689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Molecular weight 17.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val132
Aliases /Synonyms PMP2, Myelin P2 protein, Peripheral myelin protein 2
Reference ARO-P12276
Note For research use only.
Molecular Constructor
Met1–Val132
Product name ARO-P12276-50
Uniprot ID P02689
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Molecular weight 17.07 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Val132
Aliases /Synonyms PMP2, Myelin P2 protein, Peripheral myelin protein 2
Reference ARO-P12276
Note For research use only.
Molecular Constructor
Met1–Val132

Introduction

Recombinant Human PMP2 Protein, also known as Peripheral Myelin Protein 2, is a protein that plays a crucial role in the formation and maintenance of myelin sheath in the peripheral nervous system. This protein is encoded by the PMP2 gene and is highly conserved among different species, including humans. In this article, we will discuss the structure, activity, and applications of Recombinant Human PMP2 Protein.

Structure of Recombinant Human PMP2 Protein

Recombinant Human PMP2 Protein is a small, highly basic protein with a molecular weight of approximately 18 kDa. It is composed of 160 amino acids and has a characteristic beta-barrel structure. This protein has a hydrophobic core and a hydrophilic surface, which makes it an ideal candidate for myelin sheath formation. Recombinant Human PMP2 Protein also contains two cysteine residues that are important for its stability and function.

Activity of Recombinant Human PMP2 Protein

The main function of Recombinant Human PMP2 Protein is to promote the compaction and stability of myelin sheath in the peripheral nervous system. It does so by interacting with other proteins, such as myelin basic protein and proteolipid protein, to form a complex that wraps around the axons of nerve cells. This complex acts as an insulating layer, allowing for efficient transmission of nerve impulses.

Moreover, Recombinant Human PMP2 Protein also plays a role in the maintenance of myelin sheath. It has been shown to regulate the turnover of myelin proteins and lipids, ensuring the integrity and functionality of the myelin sheath. This protein is also involved in the transport of lipids within the myelin sheath, which is essential for its proper function.

Applications of Recombinant Human PMP2 Protein

Recombinant Human PMP2 Protein has a wide range of applications in both research and clinical settings. Due to its role in myelin sheath formation and maintenance, this protein has been extensively studied in the context of demyelinating diseases, such as multiple sclerosis and Charcot-Marie-Tooth disease. Researchers have used Recombinant Human PMP2 Protein to better understand the mechanisms underlying these diseases and to develop potential treatments.

In addition, Recombinant Human PMP2 Protein has also been used as an antigen in diagnostic tests for demyelinating diseases. Its high specificity and stability make it a reliable marker for the detection of these diseases. Furthermore, this protein has been studied for its potential as a therapeutic target for nerve regeneration in cases of peripheral nerve injury.

Conclusion

Recombinant Human PMP2 Protein is a crucial protein involved in the formation and maintenance of myelin sheath in the peripheral nervous system. Its unique structure and activity make it an important player in the proper functioning of the nervous system. This protein has numerous applications in both research and clinical settings, and further studies on its function and potential therapeutic uses are ongoing. With its diverse functions and potential, Recombinant Human PMP2 Protein is a valuable protein in the field of neuroscience and holds promise for future advancements in the treatment of demyelinating diseases.

Recombinant Human PMP2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PMP2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products