Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human HOXC10 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NYD6
Molecular weight:
20.82 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
Thr276–Thr342
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human HOXC10 Protein, N-His-SUMO

Product name ARO-P11893-100
Uniprot ID Q9NYD6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT
Molecular weight 20.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr276-Thr342
Aliases /Synonyms HOX3I, Homeobox protein Hox-C10, Homeobox protein Hox-3I, HOXC10
Reference ARO-P11893
Note For research use only.
Molecular Constructor
Thr276–Thr342
Product name ARO-P11893-1MG
Uniprot ID Q9NYD6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT
Molecular weight 20.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr276-Thr342
Aliases /Synonyms HOX3I, Homeobox protein Hox-C10, Homeobox protein Hox-3I, HOXC10
Reference ARO-P11893
Note For research use only.
Molecular Constructor
Thr276–Thr342
Product name ARO-P11893-50
Uniprot ID Q9NYD6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT
Molecular weight 20.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr276-Thr342
Aliases /Synonyms HOX3I, Homeobox protein Hox-C10, Homeobox protein Hox-3I, HOXC10
Reference ARO-P11893
Note For research use only.
Molecular Constructor
Thr276–Thr342

Introduction to Recombinant Human HOXC10 Protein

Recombinant Human HOXC10 Protein, also known as Homeobox C10, is a type of protein that plays a crucial role in the development and function of cells. It is a member of the homeobox family of transcription factors, which are proteins that bind to specific DNA sequences and regulate the expression of other genes. In this article, we will explore the structure, activity, and applications of Recombinant Human HOXC10 Protein.

Structure of Recombinant Human HOXC10 Protein

Recombinant Human HOXC10 Protein is a 282 amino acid protein with a molecular weight of approximately 32 kDa. It contains a conserved DNA-binding domain known as the homeodomain, which is responsible for its ability to bind to specific DNA sequences. This protein also contains a C-terminal domain that is involved in protein-protein interactions and a N-terminal domain that is responsible for its transcriptional activation activity.

Activity of Recombinant Human HOXC10 Protein

Recombinant Human HOXC10 Protein is a transcription factor that regulates the expression of target genes. It binds to specific DNA sequences, known as homeobox sequences, and activates or represses the transcription of nearby genes. This protein is involved in the development and differentiation of various cell types, including cells of the nervous system, skeletal system, and reproductive system. It also plays a role in cell proliferation and apoptosis, as well as in the regulation of immune responses.

Applications of Recombinant Human HOXC10 Protein

Recombinant Human HOXC10 Protein has a wide range of applications in both research and clinical settings. One of its main applications is in the study of gene regulation and development. By understanding how this protein functions, researchers can gain insight into the mechanisms of cell differentiation and tissue development.

In cancer research, Recombinant Human HOXC10 Protein has been found to be overexpressed in various types of cancers, including breast, lung, and prostate cancer. This makes it a potential target for cancer therapy, as inhibiting its activity could lead to the suppression of tumor growth.

Another important application of Recombinant Human HOXC10 Protein is in the field of regenerative medicine. This protein has been shown to play a critical role in the differentiation of stem cells into specific cell types. By manipulating its expression or activity, scientists can potentially direct the differentiation of stem cells into desired cell types for tissue repair and regeneration.

Moreover, Recombinant Human HOXC10 Protein has been used as an antigen in vaccine development. Its ability to regulate immune responses makes it a potential target for vaccines against infectious diseases or cancer.

Conclusion

In conclusion, Recombinant Human HOXC10 Protein is a crucial protein involved in the development and function of cells. Its unique structure and activity make it a valuable tool for studying gene regulation and cell differentiation. Its potential applications in cancer therapy, regenerative medicine, and vaccine development make it a promising target for future research and clinical use.

Recombinant Human HOXC10 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human HOXC10 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products