Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human GDF15 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99988
Molecular weight:
14.60 kDa

$392.00

100ug + 392 loyalty points
His Ala197–Ile308
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human GDF15 recombinant protein

Product name Human GDF15 recombinant protein
Uniprot ID Q99988
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Molecular weight 14.60 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala197-Ile308
Aliases /Synonyms PLAB, Placental bone morphogenetic protein, MIC1, NRG-1, PTGFB, NSAID-regulated gene 1 protein, GDF15, NAG-1, MIC-1, Prostate differentiation factor, NSAID-activated gene 1 protein, Growth/differentiation factor 15, Macrophage inhibitory cytokine 1, Placental TGF-beta, GDF-15, PDF
Reference PX-P6049
Note For research use only
Molecular Constructor
His Ala197–Ile308

Human GDF15 recombinant protein

There are no reviews yet.

Be the first to review “Human GDF15 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products