Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Visugromab Biosimilar – Anti-GDF15 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $218.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade

Product name Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade
Uniprot ID Q99988
Species Homo Sapiens
Raw Antigen Sequence MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Visugromab,,GDF15,anti-GDF15
Reference PX-TA1889
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade
Uniprot ID Q99988
Species Homo Sapiens
Raw Antigen Sequence MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Visugromab,,GDF15,anti-GDF15
Reference PX-TA1889
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1889-50
Uniprot ID Q99988
Species Homo Sapiens
Raw Antigen Sequence MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Visugromab,,GDF15,anti-GDF15
Reference PX-TA1889
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction to Visugromab Biosimilar – Anti-GDF15 mAb

Visugromab Biosimilar – Anti-GDF15 mAb is a highly specific monoclonal antibody (mAb) that targets growth differentiation factor 15 (GDF15). This biosimilar is a research grade product that has been developed for use in scientific studies and research applications. In this article, we will explore the structure, activity, and potential applications of Visugromab Biosimilar.

Structure of Visugromab Biosimilar

Visugromab Biosimilar is a recombinant humanized monoclonal antibody that has been engineered to mimic the structure of the original anti-GDF15 mAb. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the target molecule, GDF15, while the constant region determines the effector functions of the antibody.

Mechanism of Action

Visugromab Biosimilar works by binding to GDF15, a protein that is involved in various physiological processes such as inflammation, cell proliferation, and apoptosis. By binding to GDF15, Visugromab Biosimilar blocks its interaction with its receptors, thereby inhibiting downstream signaling pathways. This results in the suppression of GDF15-mediated effects, making it a potential therapeutic target for various diseases.

Title: Potential Applications

Visugromab Biosimilar has been studied for its potential applications in various disease conditions. One of the main areas of research is its role in cancer. GDF15 has been shown to promote tumor growth and metastasis, and Visugromab Biosimilar has been found to inhibit these processes in preclinical studies. It has also been investigated for its potential in treating cachexia, a wasting syndrome commonly seen in cancer patients.

In addition to cancer, Visugromab Biosimilar has also shown promise in other disease conditions such as cardiovascular diseases, diabetes, and neurodegenerative disorders. GDF15 has been implicated in the pathogenesis of these diseases, and Visugromab Biosimilar has been found to have a therapeutic effect by modulating GDF15 signaling.

Advantages of Visugromab Biosimilar

One of the main advantages of Visugromab Biosimilar is its high specificity for GDF15. This ensures that it does not interfere with other physiological processes, reducing the risk of side effects. Additionally, as a biosimilar, it is a more cost-effective alternative to the original anti-GDF15 mAb, making it more accessible for research purposes.

Title: Potential Limitations

Although Visugromab Biosimilar has shown promising results in preclinical studies, further research is needed to establish its efficacy and safety in clinical settings. Additionally, as a research grade product, it is not approved for use in humans and is only intended for scientific studies.

Conclusion

In summary, Visugromab Biosimilar – Anti-GDF15 mAb is a recombinant humanized monoclonal antibody that specifically targets GDF15. It has been engineered to mimic the structure and function of the original anti-GDF15 mAb and has shown potential in various disease conditions. As a research grade product, it is a valuable tool for scientific studies and has the potential to be developed into a therapeutic agent in the future.

SDS-PAGE for Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade

SDS-PAGE for Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade

Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Visugromab Biosimilar - Anti-GDF15 mAb - Research Grade

There are no reviews yet.

Be the first to review “Visugromab Biosimilar – Anti-GDF15 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products