Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-GDF15 Polyclonal Antibody

  • PTX19923-100
  • Validated WB
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Original price was: $262.00.Current price is: $201.00.

100ug 23% OFF + 201 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-GDF15 Polyclonal Antibody binds to Human GDF15 recombinant protein in WB Assay

Anti-GDF15 Polyclonal Antibody

Product name PTX19923-100
Uniprot ID Q99988
Raw Antigen Sequence ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-GDF15, Anti-MIC1, Anti-GDF-15
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human
Product name PTX19923-1MG
Uniprot ID Q99988
Raw Antigen Sequence ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-GDF15, Anti-MIC1, Anti-GDF-15
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human
Product name PTX19923-50
Uniprot ID Q99988
Raw Antigen Sequence ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-GDF15, Anti-MIC1, Anti-GDF-15
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Human

Anti-GDF15 Polyclonal Antibody binds to Human GDF15 recombinant protein in WB Assay

Anti-GDF15 Polyclonal Antibody binds to Human GDF15 recombinant protein in WB Assay

Human GDF15 recombinant protein(cat. No.PX-P6049) can bind Anti-GDF15 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Anti-GDF15 Polyclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products