Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

MARV VP24 recombinant protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Lake Victoria marburgvirus (strain Musoke-80) (MARV)
Uniprot ID:
P35256
Molecular weight:
55.31 kDa

Original price was: $326.00.Current price is: $271.00.

50ug 17% OFF + 271 loyalty points
GST Thr55–Leu241 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
MARV VP24 recombinant protein, N-GST & C-His

MARV VP24 recombinant protein, N-GST & C-His

Product name MARV VP24 recombinant protein, N-GST & C-His
Uniprot ID P35256
Origin species Lake Victoria marburgvirus (strain Musoke-80) (MARV)
Expression system Prokaryotic expression
Raw Antigen Sequence TLLHHLKSNFVVPEWQQTRNLFSHLFKNPKSTIIEPFLALRILLGVALKDQELQQSLIPGFRSIVHMLSEWLLLEVTSAIHISPNLLGIYLTSDMFKILMAGVKNFFNKMFTLHVVNDHGKPSSIEIKLTGQQIIITRVNMGFLVEVRRIDIEPCCGETVLSESVVFGLVAEAVLREHSQMEKGQPL
Molecular weight 55.31 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr55-Leu241
Aliases /Synonyms Membrane-associated protein VP24, Marburg VP24, mVP24, VP24
Reference ARO-P22638
Note For research use only.
Molecular Constructor
GST Thr55–Leu241 His
Product name MARV VP24 recombinant protein, N-GST & C-His
Uniprot ID P35256
Origin species Lake Victoria marburgvirus (strain Musoke-80) (MARV)
Expression system Prokaryotic expression
Raw Antigen Sequence TLLHHLKSNFVVPEWQQTRNLFSHLFKNPKSTIIEPFLALRILLGVALKDQELQQSLIPGFRSIVHMLSEWLLLEVTSAIHISPNLLGIYLTSDMFKILMAGVKNFFNKMFTLHVVNDHGKPSSIEIKLTGQQIIITRVNMGFLVEVRRIDIEPCCGETVLSESVVFGLVAEAVLREHSQMEKGQPL
Molecular weight 55.31 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr55-Leu241
Aliases /Synonyms Membrane-associated protein VP24, Marburg VP24, mVP24, VP24
Reference ARO-P22638
Note For research use only.
Molecular Constructor
GST Thr55–Leu241 His
Product name MARV VP24 recombinant protein, N-GST & C-His
Uniprot ID P35256
Origin species Lake Victoria marburgvirus (strain Musoke-80) (MARV)
Expression system Prokaryotic expression
Raw Antigen Sequence TLLHHLKSNFVVPEWQQTRNLFSHLFKNPKSTIIEPFLALRILLGVALKDQELQQSLIPGFRSIVHMLSEWLLLEVTSAIHISPNLLGIYLTSDMFKILMAGVKNFFNKMFTLHVVNDHGKPSSIEIKLTGQQIIITRVNMGFLVEVRRIDIEPCCGETVLSESVVFGLVAEAVLREHSQMEKGQPL
Molecular weight 55.31 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr55-Leu241
Aliases /Synonyms Membrane-associated protein VP24, Marburg VP24, mVP24, VP24
Reference ARO-P22638
Note For research use only.
Molecular Constructor
GST Thr55–Leu241 His

There are no reviews yet.

Be the first to review “MARV VP24 recombinant protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products