Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CCL8/MCP-2 Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q9Z121
Molecular weight:
11.88 kDa

Original price was: $333.00.Current price is: $271.00.

50ug 19% OFF + 271 loyalty points
Glu20–Pro97 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse CCL8/MCP-2 Recombinant Protein, C-His

Product name ARO-P21092-100
Uniprot ID Q9Z121
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Molecular weight 11.88 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu20-Pro97
Aliases /Synonyms C-C motif chemokine 8, CCL8, HC14, MCP-2, MCP-2(6-76), MCP2, Monocyte chemoattractant protein 2, Monocyte chemotactic protein 2, SCYA10, SCYA8, Small-inducible cytokine A8
Reference ARO-P21092
Note For research use only.
Molecular Constructor
Glu20–Pro97 His
Product name ARO-P21092-1MG
Uniprot ID Q9Z121
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Molecular weight 11.88 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu20-Pro97
Aliases /Synonyms C-C motif chemokine 8, CCL8, HC14, MCP-2, MCP-2(6-76), MCP2, Monocyte chemoattractant protein 2, Monocyte chemotactic protein 2, SCYA10, SCYA8, Small-inducible cytokine A8
Reference ARO-P21092
Note For research use only.
Molecular Constructor
Glu20–Pro97 His
Product name ARO-P21092-50
Uniprot ID Q9Z121
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Molecular weight 11.88 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu20-Pro97
Aliases /Synonyms C-C motif chemokine 8, CCL8, HC14, MCP-2, MCP-2(6-76), MCP2, Monocyte chemoattractant protein 2, Monocyte chemotactic protein 2, SCYA10, SCYA8, Small-inducible cytokine A8
Reference ARO-P21092
Note For research use only.
Molecular Constructor
Glu20–Pro97 His

There are no reviews yet.

Be the first to review “Mouse CCL8/MCP-2 Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products