Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse EFNA3 Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
O08545

Original price was: $328.00.Current price is: $271.00.

50ug 17% OFF + 271 loyalty points
Met1–Gly206 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Mouse EFNA3 Recombinant Protein, C-His

Mouse EFNA3 Recombinant Protein, C-His

Product name ARO-P18183-100
Uniprot ID O08545
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISG
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly206
Aliases /Synonyms Ephrin-A3, EHK1 ligand, EHK1-L, EPH-related receptor tyrosine kinase ligand 3, LERK-3, Efna3, Epl3, Eplg3, Lerk3
Reference ARO-P18183
Note For research use only.
Molecular Constructor
Met1–Gly206 His
Product name ARO-P18183-1MG
Uniprot ID O08545
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISG
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly206
Aliases /Synonyms Ephrin-A3, EHK1 ligand, EHK1-L, EPH-related receptor tyrosine kinase ligand 3, LERK-3, Efna3, Epl3, Eplg3, Lerk3
Reference ARO-P18183
Note For research use only.
Molecular Constructor
Met1–Gly206 His
Product name ARO-P18183-50
Uniprot ID O08545
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISG
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Gly206
Aliases /Synonyms Ephrin-A3, EHK1 ligand, EHK1-L, EPH-related receptor tyrosine kinase ligand 3, LERK-3, Efna3, Epl3, Eplg3, Lerk3
Reference ARO-P18183
Note For research use only.
Molecular Constructor
Met1–Gly206 His

SDS-PAGE for Mouse EFNA3 Recombinant Protein, C-His

SDS-PAGE for Mouse EFNA3 Recombinant Protein, C-His

Mouse EFNA3 Recombinant Protein, C-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Mouse EFNA3 Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products