Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD122/IL2RB Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P16297

Original price was: $333.00.Current price is: $271.00.

50ug 19% OFF + 271 loyalty points
Ala27–Glu240 Fc
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Mouse CD122/IL2RB Recombinant Protein, C-Fc

Mouse CD122/IL2RB Recombinant Protein, C-Fc

Product name PX-P7033-100
Uniprot ID P16297
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala27-Glu240
Aliases /Synonyms Interleukin-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, High affinity IL-2 receptor subunit beta, Interleukin-15 receptor subunit beta, p70-75, p75, CD122, IL2RB
Reference PX-P7033
Note For research use only.
Molecular Constructor
Ala27–Glu240 Fc
Product name PX-P7033-1MG
Uniprot ID P16297
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala27-Glu240
Aliases /Synonyms Interleukin-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, High affinity IL-2 receptor subunit beta, Interleukin-15 receptor subunit beta, p70-75, p75, CD122, IL2RB
Reference PX-P7033
Note For research use only.
Molecular Constructor
Ala27–Glu240 Fc
Product name PX-P7033-50
Uniprot ID P16297
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala27-Glu240
Aliases /Synonyms Interleukin-2 receptor subunit beta, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, High affinity IL-2 receptor subunit beta, Interleukin-15 receptor subunit beta, p70-75, p75, CD122, IL2RB
Reference PX-P7033
Note For research use only.
Molecular Constructor
Ala27–Glu240 Fc

SDS-PAGE for Mouse CD122/IL2RB Recombinant Protein, C-Fc

SDS-PAGE for Mouse CD122/IL2RB Recombinant Protein, C-Fc

Mouse CD122/IL2RB Recombinant Protein, C-Fc, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Mouse CD122/IL2RB Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products