Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Canine IL31 recombinant protein

Host species:
Mammalian cells
Origin species:
Canis lupus familiaris (Dog) (Canis familiaris)
Uniprot ID:
C7G0W1
Molecular weight:
18.27 kDa

$500.00

100ug + 500 loyalty points
Ser24–Gln159 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Canine IL31 recombinant protein

Product name Canine IL31 recombinant protein
Uniprot ID C7G0W1
Origin species Canis lupus familiaris (Dog) (Canis familiaris)
Expression system Eukaryotic expression
Raw Antigen Sequence SHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNS
Molecular weight 18.27 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser24-Gln159
Aliases /Synonyms IL-31, Interleukin-31, IL31
Reference PX-P6267
Note For research use only
Molecular Constructor
Ser24–Gln159 His

SDS-PAGE for Canine IL31 recombinant protein

SDS-PAGE for Canine IL31 recombinant protein

Canine IL31 recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Canine IL31 recombinant protein

There are no reviews yet.

Be the first to review “Canine IL31 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products