Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Nile tilapia NCCRP1 recombinant protein

Host species:
Mammalian cells
Origin species:
Nile tilapia
Uniprot ID:
I3KFP2
Molecular weight:
27.56 kDa

$500.00

100ug + 500 loyalty points
Met1–Pro233 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Nile tilapia NCCRP1 recombinant protein

Product name Nile tilapia NCCRP1 recombinant protein
Uniprot ID I3KFP2
Origin species Nile tilapia
Expression system Eukaryotic expression
Raw Antigen Sequence MSAAEWKKKCEEEWSLQGAPMPDGLDWKSVYEAKPFGRNLLKNPAPYGLSKDVPPPEPELPAVPDRGPPRFQPDGDFTGWTTNTEVLPYDTSGIPKGVAVCALPRYSWFIMEQVVDLKAERLWDELLDEFQPEIAIQDWYEESQLHDSIYQLHVKLLGADKNTVISEHTVNPTEQRQAYSHKWKEVSHVFSGYGPGVRYVHFLHRLKNSFLNGFHNTRFTGSAVIVRPSKSSP
Molecular weight 27.56 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Pro233
Aliases /Synonyms NCCRP-1, NCCRP1, NCC receptor protein 1 homolog, F-box only protein 50, FBXO50, Non-specific cytotoxic cell receptor protein 1 homolog
Reference PX-P6115
Note For research use only
Molecular Constructor
Met1–Pro233 His

Nile tilapia NCCRP1 recombinant protein

There are no reviews yet.

Be the first to review “Nile tilapia NCCRP1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products