Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD264-TNFRSF10D recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9UBN6
Molecular weight:
49.10 kDa

$249.00

100ug + 249 loyalty points
Met1–His211 Fc
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD264-TNFRSF10D recombinant protein

Product name Human CD264-TNFRSF10D recombinant protein
Uniprot ID Q9UBN6
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH
Molecular weight 49.10 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His211
Aliases /Synonyms TRAIL-R4, TRAIL receptor 4, DcR2, TRAIL receptor with a truncated death domain, TRUNDD, DCR2, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAILR4, TNFRSF10D, Tumor necrosis factor receptor superfamily member 10D, CD264
Reference PX-P6230
Note For research use only
Molecular Constructor
Met1–His211 Fc

SDS-PAGE for Human CD264-TNFRSF10D recombinant protein

SDS-PAGE for Human CD264-TNFRSF10D recombinant protein

Human CD264-TNFRSF10D recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human CD264-TNFRSF10D recombinant protein

There are no reviews yet.

Be the first to review “Human CD264-TNFRSF10D recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products