Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse DCN Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P28654
Molecular weight:
40.78 kDa

Original price was: $342.00.Current price is: $271.00.

50ug 21% OFF + 271 loyalty points
Met1–Lys354 His
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse DCN Recombinant Protein, C-His

Mouse DCN Recombinant Protein, C-His

Product name ARO-P21237-100
Uniprot ID P28654
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MKATLIFFLLAQVSWAGPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Molecular weight 40.78 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys354
Aliases /Synonyms Bone proteoglycan II, DCN, Decorin, PG-S2, PG40, SLRR1B
Reference ARO-P21237
Note For research use only.
Molecular Constructor
Met1–Lys354 His
Product name ARO-P21237-1MG
Uniprot ID P28654
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MKATLIFFLLAQVSWAGPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Molecular weight 40.78 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys354
Aliases /Synonyms Bone proteoglycan II, DCN, Decorin, PG-S2, PG40, SLRR1B
Reference ARO-P21237
Note For research use only.
Molecular Constructor
Met1–Lys354 His
Product name ARO-P21237-50
Uniprot ID P28654
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence MKATLIFFLLAQVSWAGPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Molecular weight 40.78 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Lys354
Aliases /Synonyms Bone proteoglycan II, DCN, Decorin, PG-S2, PG40, SLRR1B
Reference ARO-P21237
Note For research use only.
Molecular Constructor
Met1–Lys354 His

There are no reviews yet.

Be the first to review “Mouse DCN Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products