Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse IL1RL2/IL-36R Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q9ERS7
Molecular weight:
38.92 kDa

Original price was: $339.00.Current price is: $271.00.

50ug 20% OFF + 271 loyalty points
Asp22–Arg338 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse IL1RL2/IL-36R Recombinant Protein, C-His

Product name ARO-P20717-100
Uniprot ID Q9ERS7
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR
Molecular weight 38.92 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp22-Arg338
Aliases /Synonyms EC:3.2.2.6, IL-1Rrp2, IL-36 receptor, IL-36R, IL1R-rp2, IL1RL2, IL1RRP2, Interleukin-1 receptor-like 2, Interleukin-1 receptor-related protein 2
Reference ARO-P20717
Note For research use only.
Molecular Constructor
Asp22–Arg338 His
Product name ARO-P20717-1MG
Uniprot ID Q9ERS7
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR
Molecular weight 38.92 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp22-Arg338
Aliases /Synonyms EC:3.2.2.6, IL-1Rrp2, IL-36 receptor, IL-36R, IL1R-rp2, IL1RL2, IL1RRP2, Interleukin-1 receptor-like 2, Interleukin-1 receptor-related protein 2
Reference ARO-P20717
Note For research use only.
Molecular Constructor
Asp22–Arg338 His
Product name ARO-P20717-50
Uniprot ID Q9ERS7
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR
Molecular weight 38.92 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asp22-Arg338
Aliases /Synonyms EC:3.2.2.6, IL-1Rrp2, IL-36 receptor, IL-36R, IL1R-rp2, IL1RL2, IL1RRP2, Interleukin-1 receptor-like 2, Interleukin-1 receptor-related protein 2
Reference ARO-P20717
Note For research use only.
Molecular Constructor
Asp22–Arg338 His

There are no reviews yet.

Be the first to review “Mouse IL1RL2/IL-36R Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products