Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse MIOX Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9QXN5
Molecular weight:
35.33 kDa

Original price was: $303.00.Current price is: $271.00.

50ug 11% OFF + 271 loyalty points
His Met1–Trp285
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse MIOX Recombinant Protein, N-His

Product name ARO-P21285-100
Uniprot ID Q9QXN5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MKVDVGPDPSLVYRPDVDPEMAKSKDSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVSRKRIQYGSFSYKKMTIMEAVGMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKIMALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPYYQGLIDKYCPGTLSW
Molecular weight 35.33 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Trp285
Aliases /Synonyms Aldehyde reductase-like 6, Aldrl6, EC:1.13.99.1, Inositol oxygenase, MI oxygenase, Miox, Myo-inositol oxygenase, Renal-specific oxidoreductase, Rsor
Reference ARO-P21285
Note For research use only.
Molecular Constructor
His Met1–Trp285
Product name ARO-P21285-1MG
Uniprot ID Q9QXN5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MKVDVGPDPSLVYRPDVDPEMAKSKDSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVSRKRIQYGSFSYKKMTIMEAVGMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKIMALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPYYQGLIDKYCPGTLSW
Molecular weight 35.33 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Trp285
Aliases /Synonyms Aldehyde reductase-like 6, Aldrl6, EC:1.13.99.1, Inositol oxygenase, MI oxygenase, Miox, Myo-inositol oxygenase, Renal-specific oxidoreductase, Rsor
Reference ARO-P21285
Note For research use only.
Molecular Constructor
His Met1–Trp285
Product name ARO-P21285-50
Uniprot ID Q9QXN5
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MKVDVGPDPSLVYRPDVDPEMAKSKDSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVSRKRIQYGSFSYKKMTIMEAVGMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKIMALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMIRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPDVESLRPYYQGLIDKYCPGTLSW
Molecular weight 35.33 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Trp285
Aliases /Synonyms Aldehyde reductase-like 6, Aldrl6, EC:1.13.99.1, Inositol oxygenase, MI oxygenase, Miox, Myo-inositol oxygenase, Renal-specific oxidoreductase, Rsor
Reference ARO-P21285
Note For research use only.
Molecular Constructor
His Met1–Trp285

Mouse MIOX Recombinant Protein, N-His

Biological Function:
Mouse MIOX Recombinant Protein, N-His is a highly purified and bioactive protein that belongs to the myo-inositol oxygenase (MIOX) family. MIOX enzymes are responsible for the conversion of myo-inositol to D-glucuronic acid, a key step in the myo-inositol metabolism pathway. This protein is produced in E. coli and contains a N-terminal histidine tag for easy purification.

Main Applications:
Mouse MIOX Recombinant Protein, N-His is an essential tool for studying myo-inositol metabolism and its role in various biological processes. It is commonly used in biochemical and biomedical research, drug discovery, and diagnostic assays. This protein can also be used in enzyme replacement therapy for MIOX deficiency disorders.

Experimental Use Cases:
– Investigating the role of myo-inositol metabolism in cancer and other diseases: Studies have shown that MIOX enzymes play a crucial role in cancer cell proliferation and survival. Mouse MIOX Recombinant Protein, N-His can be used to study the effects of MIOX inhibition or overexpression on cancer cells, providing valuable insights into potential therapeutic targets.
– Developing new drugs targeting myo-inositol metabolism: The dysregulation of myo-inositol metabolism has been linked to various diseases, making it a promising target for drug development. Mouse MIOX Recombinant Protein, N-His can be used to screen and identify potential drug candidates that modulate MIOX activity.
– Measuring MIOX activity in biological samples: Mouse MIOX Recombinant Protein, N-His can be used in enzymatic assays to measure MIOX activity in biological samples. This is particularly useful in diagnosing MIOX deficiency disorders and monitoring treatment efficacy.

In conclusion, Mouse MIOX Recombinant Protein, N-His is a high-quality and versatile tool for studying myo-inositol metabolism and its implications in various biological processes. Its applications in research, drug discovery, and diagnostic assays make it an essential protein for biotech laboratories. With its N-terminal histidine tag and purity, it offers reliable and reproducible results for your experiments. Order now and unlock the potential of myo-inositol metabolism research.

There are no reviews yet.

Be the first to review “Mouse MIOX Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products