Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse SDC4 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
O35988
Molecular weight:
16.35 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Glu24–Val146 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Mouse SDC4 recombinant protein

Mouse SDC4 recombinant protein

Product name PX-P6513-100
Uniprot ID O35988
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEV
Molecular weight 16.35 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu24-Val146
Aliases /Synonyms Syndecan-4, Amphiglycan, Ryudocan core protein, SDC4SYND4,
Reference PX-P6513
Molecular Constructor
Glu24–Val146 His
Product name PX-P6513-1MG
Uniprot ID O35988
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEV
Molecular weight 16.35 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu24-Val146
Aliases /Synonyms Syndecan-4, Amphiglycan, Ryudocan core protein, SDC4SYND4,
Reference PX-P6513
Molecular Constructor
Glu24–Val146 His
Product name PX-P6513-50
Uniprot ID O35988
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEV
Molecular weight 16.35 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu24-Val146
Aliases /Synonyms Syndecan-4, Amphiglycan, Ryudocan core protein, SDC4SYND4,
Reference PX-P6513
Molecular Constructor
Glu24–Val146 His

SDS-PAGE for Mouse SDC4 recombinant protein

SDS-PAGE for Mouse SDC4 recombinant protein

Mouse SDC4 recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Mouse SDC4 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products