Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade

  • PX-TA1115-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG2a-nd

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

Product name Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade
Uniprot ID P01911
Species Mus musculus
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Oncolym,Iodine 131-ILym-1,Lym-1,Oncolym,HLA-DR10,anti-HLA-DR10
Reference PX-TA1115
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-nd
Clonality Monoclonal Antibody
Product name Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade
Uniprot ID P01911
Species Mus musculus
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Oncolym,Iodine 131-ILym-1,Lym-1,Oncolym,HLA-DR10,anti-HLA-DR10
Reference PX-TA1115
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-nd
Clonality Monoclonal Antibody
Product name PX-TA1115-50
Uniprot ID P01911
Species Mus musculus
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Oncolym,Iodine 131-ILym-1,Lym-1,Oncolym,HLA-DR10,anti-HLA-DR10
Reference PX-TA1115
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2a-nd
Clonality Monoclonal Antibody

Introduction to Oncolym Biosimilar – Anti-HLA-DR10 mAb

Oncolym Biosimilar – Anti-HLA-DR10 mAb is a research grade monoclonal antibody that has been developed as a biosimilar to treat various types of cancers. This antibody is specifically designed to target the human leukocyte antigen (HLA) class II molecule, HLA-DR10, which is overexpressed in certain cancer cells. In this article, we will delve into the structure, activity, and potential applications of Oncolym Biosimilar – Anti-HLA-DR10 mAb.

Structure of Oncolym Biosimilar – Anti-HLA-DR10 mAb

Oncolym Biosimilar – Anti-HLA-DR10 mAb is a recombinant humanized IgG1 monoclonal antibody. It is composed of two identical heavy chains and two identical light chains, each containing a variable and a constant region. The variable region of the antibody is responsible for binding to the HLA-DR10 molecule, while the constant region mediates the effector functions of the antibody.

Activity of Oncolym Biosimilar – Anti-HLA-DR10 mAb

The main activity of Oncolym Biosimilar – Anti-HLA-DR10 mAb is its ability to bind to the HLA-DR10 molecule on cancer cells. HLA-DR10 is a major histocompatibility complex (MHC) class II molecule that is involved in presenting antigens to T cells. In cancer cells, HLA-DR10 is overexpressed, which helps the cancer cells evade the immune system. By targeting HLA-DR10, Oncolym Biosimilar – Anti-HLA-DR10 mAb can block this immune evasion and enhance the body’s natural ability to recognize and destroy cancer cells.

In addition to its binding activity, Oncolym Biosimilar – Anti-HLA-DR10 mAb also has effector functions that can contribute to its anti- cancer activity. These include antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and complement-dependent cytotoxicity (CDC). These mechanisms involve the recruitment and activation of immune cells to attack cancer cells, leading to their destruction.

Potential Applications of Oncolym Biosimilar – Anti-HLA-DR10 mAb

Oncolym Biosimilar – Anti-HLA-DR10 mAb has the potential to be used in the treatment of various types of cancers. As mentioned earlier, HLA-DR10 is overexpressed in certain cancer cells, including lymphomas, leukemias, and solid tumors such as breast, lung, and ovarian cancers. By targeting HLA-DR10, Oncolym Biosimilar – Anti-HLA-DR10 mAb can potentially inhibit cancer growth and improve patient outcomes.

In addition to its potential as a monotherapy, Oncolym Biosimilar – Anti-HLA-DR10 mAb can also be used in combination with other cancer treatments. For example, it can be used in combination with chemotherapy or radiation therapy to enhance their efficacy. It can also be combined with other immunotherapies, such as checkpoint inhibitors, to further boost the body’s immune response against cancer cells.

Conclusion

In conclusion, Oncolym Biosimilar – Anti-HLA-DR10 mAb is a research grade monoclonal antibody that has been specifically designed to target the HLA-DR10 molecule, which is overexpressed in certain cancer cells. Its structure, activity, and potential applications make it a promising candidate for the treatment of various types of cancers. Further research and clinical trials are needed to fully evaluate the potential of this antibody in cancer therapy.

SEC-HPLC of Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

SEC-HPLC of Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

SDS-PAGE for Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Oncolym Biosimilar - Anti-HLA-DR10 mAb - Research Grade

There are no reviews yet.

Be the first to review “Oncolym Biosimilar – Anti-HLA-DR10 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products