Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Xaluritamig Biosimilar – Anti-STEAP family member 1 and CD3e mAb – Research Grade

  • PX-TA2096-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1-scFv-CH/G1-kappa

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

Product name Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade
Uniprot ID Q9UHE8 & P07766
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-STEAP family member 1, six transmembrane epithelial antigen of the prostate 1, STEAP1 metalloreductase, CD3E
Reference PX-TA2096
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-scFv-CH/G1-kappa
Clonality Monoclonal Antibody
Product name Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade
Uniprot ID Q9UHE8 & P07766
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-STEAP family member 1, six transmembrane epithelial antigen of the prostate 1, STEAP1 metalloreductase, CD3E
Reference PX-TA2096
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-scFv-CH/G1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2096-50
Uniprot ID Q9UHE8 & P07766
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-STEAP family member 1, six transmembrane epithelial antigen of the prostate 1, STEAP1 metalloreductase, CD3E
Reference PX-TA2096
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-scFv-CH/G1-kappa
Clonality Monoclonal Antibody

Title: Xaluritamig Biosimilar – A Novel Antibody Targeting STEAP Family Member 1 and CD3e for Therapeutic Applications

Introduction:

Xaluritamig Biosimilar is a novel antibody that has been developed as a biosimilar of the existing drug, Xaluritamig, which targets STEAP family member 1 (STEAP1) and CD3e. This biosimilar is a research grade antibody with potential therapeutic applications in various diseases. In this article, we will discuss the structure, activity, and potential applications of Xaluritamig Biosimilar in detail.

Structure of Xaluritamig Biosimilar:

Xaluritamig Biosimilar is a monoclonal antibody that is specifically designed to target STEAP1 and CD3e. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for recognizing and binding to the target proteins, while the constant regions provide stability and effector functions. The antibody also contains a Fc region that can interact with immune cells and mediate effector functions.

Activity of Xaluritamig Biosimilar:

Xaluritamig Biosimilar is a potent inhibitor of STEAP1 and CD3e, both of which are important therapeutic targets in various diseases. STEAP1 is a transmembrane protein that is overexpressed in many types of cancer, including prostate, bladder, and breast cancer. It plays a crucial role in tumor growth, invasion, and metastasis, making it an attractive target for cancer therapy. On the other hand, CD3e is a component of the T-cell receptor complex and is involved in T-cell activation. Dysregulation of CD3e signaling has been implicated in autoimmune diseases and cancer. By targeting both STEAP1 and CD3e, Xaluritamig Biosimilar has the potential to inhibit tumor growth and modulate immune responses.

Applications of Xaluritamig Biosimilar:

1.

Cancer Therapy:

As mentioned earlier, STEAP1 is overexpressed in various types of cancer, making it an ideal target for cancer therapy. Xaluritamig Biosimilar can bind to STEAP1 on cancer cells, leading to inhibition of tumor growth and metastasis. Additionally, by targeting CD3e, the antibody can also activate T-cells, which can further enhance the anti-tumor response. Xaluritamig Biosimilar has the potential to be used as a monotherapy or in combination with other anti- cancer agents.

2. Autoimmune Diseases:

Dysregulation of CD3e signaling has been linked to autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, and type 1 diabetes. By targeting CD3e, Xaluritamig Biosimilar can modulate T-cell activation and reduce the inflammatory response in these diseases. This makes it a promising candidate for the treatment of autoimmune diseases.

3. Immunotherapy:

Immunotherapy has emerged as a promising approach for cancer treatment by harnessing the power of the immune system. Xaluritamig Biosimilar can be used as a research tool to study the role of STEAP1 and CD3e in tumor growth and immune responses. It can also be used in the development of new immunotherapeutic strategies.

Conclusion:

Xaluritamig Biosimilar is a novel antibody that targets both STEAP1 and CD3e, with potential applications in cancer therapy, autoimmune diseases, and immunotherapy. Its unique dual targeting mechanism makes it a promising candidate for the treatment of various diseases. Further research and clinical trials are needed to fully explore the therapeutic potential of this biosimilar.

SEC-HPLC of Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

SEC-HPLC of Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

SDS-PAGE for Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Xaluritamig Biosimilar - Anti-STEAP family member 1 and CD3e mAb - Research Grade

There are no reviews yet.

Be the first to review “Xaluritamig Biosimilar – Anti-STEAP family member 1 and CD3e mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products