Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

PAPD7 MOUSE Protein

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q6PB75
Molecular weight:
61.05kDa

$469.00

100ug + 469 loyalty points
Ser2–Arg542
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

PAPD7 MOUSE Protein

Product name PAPD7 MOUSE Protein (8812)
Uniprot ID Q6PB75
Uniprot link https://www.uniprot.org/uniprot/Q6PB75
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRK HNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGG ISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCI EDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDSESTLGRIIKVTQEVIDYRRWIKEKWGSRILPSP DLDNRIKIKERITTCNGEQMQSREPSSPYTQRLTLSLSSPQLLSSGSSASSVSSLSGSDIDSDTPPCTTPSVYQFSLQAP TTLMASLPTALPMPSSKPQPAASRTLIMTTNNQTRVTIPPPTLGVAPVPCRQAGVDGTTSLKAVHSVTSPAIPSASPNPL SSPHLYHKQHNGMKLSMKGSHNHTQGGGYSSVGSGAVRPPVGNRGHHQYNRTGWRRKKHAHTRDSLPVSLSR
Molecular weight 61.05kDa
Purity estimated 85%
Buffer TBS pH7.5 with urea 4M
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Arg542
Aliases /Synonyms Terminal nucleotidyltransferase 4A, DNA polymerase sigma, Non-canonical poly(A) RNA polymerase PAPD7, PAP-associated domain-containing protein 7, TRAMP-like complex polyadenylate polymerase , Terminal guanylyltransferase
Reference PX-P4254
Note For research use only
Molecular Constructor
Ser2–Arg542
Product name PAPD7 MOUSE Protein
Uniprot ID Q6PB75
Uniprot link https://www.uniprot.org/uniprot/Q6PB75
Origin species House Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRK HNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGG ISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCI EDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDSESTLGRIIKVTQEVIDYRRWIKEKWGSRILPSP DLDNRIKIKERITTCNGEQMQSREPSSPYTQRLTLSLSSPQLLSSGSSASSVSSLSGSDIDSDTPPCTTPSVYQFSLQAP TTLMASLPTALPMPSSKPQPAASRTLIMTTNNQTRVTIPPPTLGVAPVPCRQAGVDGTTSLKAVHSVTSPAIPSASPNPL SSPHLYHKQHNGMKLSMKGSHNHTQGGGYSSVGSGAVRPPVGNRGHHQYNRTGWRRKKHAHTRDSLPVSLSR
Molecular weight 61.05kDa
Purity estimated 85%
Buffer TBS pH7.5 with urea 4M
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser2-Arg542
Aliases /Synonyms Terminal nucleotidyltransferase 4A, DNA polymerase sigma, Non-canonical poly(A) RNA polymerase PAPD7, PAP-associated domain-containing protein 7, TRAMP-like complex polyadenylate polymerase, Terminal guanylyltransferase
Reference PX-P4254
Note For research use only
Molecular Constructor
Ser2–Arg542

General information on PAPD7 Mouse Protein

PAPD7 protein is a member of non-canonical poly(A) polymerases family of proteins. This family of proteins is also known as Cidl1-like proteins (after the founding member of the family). Non-canonical poly(A) polymerases have similar central domain and catalytic activities as canonical poly(A) polymerases. However, the two groups differ in nucleotide-bases recognition motif. Canonical poly(A) polymerases are responsible for the addition of a poly(A) tail to the 3’ end by poly(A) polymerases to mRNAs which leads to their degradation. Non canonical PAPs, such as PAPD7 are responsible for the terminal nucleotidyltransferase. The latter catalyzes preferentially the transfer of GTP and ATP on RNA 3′ poly(A) tail creating a heterogeneous 3′ poly(A) tail leading to mRNAs stabilization by protecting mRNAs from active deadenylation. Other members of this family of proteins may also be involved in the addition of uridyl residues of RNAs. PAPD7 is located in the nucleus, cytosol, Golgi apparatus, mitochondria, lysosome, cytosol and extracellular media.
PAPD7 stands for PAP associated domain containing 7 protein. This protein is also known as terminal nucleotidyltransferase 4 or TENT4A. It’s a non-canonical poly(A) RNA polymerase which catalyze the addition of poly(A) tail to the 3’ end of RNA responsible. This process plays a pivotal role in gene expression regulation and is involved in a post-transcriptional quality control mechanism. PAPD7 protein is the catalytic subunit of a TRAMP-like complex responsible for RNA polymerase activity. The latter is a multiprotein, heterotrimerix complex with polyadenylation activity. Other than PAPD7 polymerase related activity, TRAMP-like complex also exhibits RNA helicase activity. Other functions of PAPD7 protein also include ATP binding, guanylyltransferase activity, metal ion binding, polynucleotide adenylyltransferase activity, SMC family protein binding. PAPD7 is involved in biological processes such as double-strand break repair, histone mRNA catabolic process, mitotic chromosome condensation, mRNA processing, negative regulation of nuclear-transcribed mRNA poly(A) tail shortening, positive regulation of 3′-UTR-mediated mRNA stabilization, response to drug, RNA 3′ uridylation, sister chromatid cohesion and snoRNA polyadenylation

There are no reviews yet.

Be the first to review “PAPD7 MOUSE Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products