Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pasotuxizumab Biosimilar – Anti-CD3E, FOLH1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
(scFv-heavy-kappa)-(scFv-heavy-lambda) His-Tag

Original price was: $224.00.Current price is: $167.00.

50ug 25% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Pasotuxizumab Biosimilar - Anti-CD3E, FOLH1 mAb - Research Grade

Product name Pasotuxizumab Biosimilar - Anti-CD3E, FOLH1 mAb - Research Grade
Uniprot ID Q04609 & P07766
Source CAS 1442657-12-6
Species Chimeric,Humanized
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Pasotuxizumab,BAY 2010112,BITE MT112,MT-112,CD3E, FOLH1,anti-CD3E, FOLH1
Reference PX-TA1353
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype (scFv-heavy-kappa)-(scFv-heavy-lambda) His-Tag
Clonality Monoclonal Antibody
Product name Pasotuxizumab Biosimilar - Anti-CD3E, FOLH1 mAb - Research Grade
Uniprot ID Q04609 & P07766
Source CAS 1442657-12-6
Species Chimeric,Humanized
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Pasotuxizumab,BAY 2010112,BITE MT112,MT-112,CD3E, FOLH1,anti-CD3E, FOLH1
Reference PX-TA1353
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype (scFv-heavy-kappa)-(scFv-heavy-lambda) His-Tag
Clonality Monoclonal Antibody
Product name PX-TA1353-50
Uniprot ID Q04609 & P07766
Source CAS 1442657-12-6
Species Chimeric,Humanized
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Pasotuxizumab,BAY 2010112,BITE MT112,MT-112,CD3E, FOLH1,anti-CD3E, FOLH1
Reference PX-TA1353
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype (scFv-heavy-kappa)-(scFv-heavy-lambda) His-Tag
Clonality Monoclonal Antibody

Introduction to Pasotuxizumab Biosimilar – Anti-CD3E, FOLH1 mAb

Pasotuxizumab Biosimilar is a monoclonal antibody that targets two important proteins, CD3E and FOLH1, and is currently being researched for its potential therapeutic applications. This biosimilar is designed to mimic the structure and function of the original antibody, providing a more cost-effective option for patients in need of this treatment.

Structure of Pasotuxizumab Biosimilar

Pasotuxizumab Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced through genetic engineering techniques to resemble human antibodies. It is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with the variable regions of the heavy and light chains forming the antigen-binding site.

Title: Targeting CD3E and FOLH1

CD3E is a protein found on the surface of T-cells, a type of immune cell responsible for fighting off infections and diseases. It plays a crucial role in activating T-cells and initiating an immune response. FOLH1, also known as prostate-specific membrane antigen (PSMA), is a protein found on the surface of prostate cancer cells. It is highly expressed in prostate cancer and is considered a promising therapeutic target.

Mechanism of Action

Pasotuxizumab Biosimilar works by binding to both CD3E and FOLH1, leading to the activation of T-cells and the destruction of prostate cancer cells. When the antibody binds to CD3E, it triggers a signaling cascade that activates T-cells, causing them to release cytokines and other substances that can kill cancer cells. At the same time, the binding of the antibody to FOLH1 blocks the growth and survival of prostate cancer cells.

Title: Potential Applications

Pasotuxizumab Biosimilar is being researched for its potential use in the treatment of prostate cancer. By targeting both CD3E and FOLH1, it has the potential to effectively kill cancer cells and slow down the progression of the disease. It is also being studied for its potential use in combination with other cancer therapies, such as chemotherapy and radiation, to enhance their effectiveness.

Advantages of Pasotuxizumab Biosimilar

As a biosimilar, Pasotuxizumab offers several advantages over the original antibody. First and foremost, it is expected to be more cost-effective, making it more accessible to patients in need. It also has a similar structure and mechanism of action as the original antibody, ensuring its effectiveness and safety. Additionally, as a research grade antibody, it can be used in various studies and experiments to further understand its potential therapeutic applications.

Conclusion

In conclusion, Pasotuxizumab Biosimilar is a promising monoclonal antibody that targets CD3E and FOLH1, two important proteins involved in immune response and prostate cancer. Its structure and mechanism of action make it a potentially effective treatment option for prostate cancer, and its biosimilar nature offers several advantages over the original antibody. Further research and clinical trials are needed to fully explore its potential in cancer therapy.

Pasotuxizumab Biosimilar - Anti-FOLH1;PSMA and CD3E mAb - Research Grade in ELISA Assay

Pasotuxizumab Biosimilar - Anti-FOLH1;PSMA and CD3E mAb - Research Grade in ELISA Assay

Pasotuxizumab Biosimilar - Anti-FOLH1;PSMA and CD3E mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Pasotuxizumab Biosimilar - Anti-CD3E, FOLH1 mAb - Research Grade

  • Vele — April 6, 2022

    Great product!

Show only reviews in English (1)

Add a review

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products