Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Plasmodium falciparum PFL1260 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Plasmodium falciparum
Uniprot ID:
Q8I5F6
Molecular weight:
37,55 kDa

$782.00

100ug + 782 loyalty points
Full-length Yes
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Plasmodium falciparum PFL1260 Recombinant Protein

Plasmodium falciparum PFL1260 Recombinant Protein

Product name Plasmodium falciparum PFL1260 Recombinant Protein
Uniprot ID Q8I5F6
Uniprot link http://www.uniprot.org/uniprot/Q8I5F6
Origin species Plasmodium falciparum
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMLKHKYNDSCVQELFYKNNIKLIAIDIDGTLADDTGKISDENLKAIEVCKKGGIEIILASGRLHSYAMK MFTNEQIEKYKIEKLDGVYSHGAYIHMKGYDYVYRKFSYKDLELILFSLGSYNILRNAVFLTVDSAYVINDDIKLIEEYI YTPESEGIISDIEYVKIIDTNYKPILINKIKDIFNIGDIVSIEIYDKLYPNQDIYSDLFKVLFYELQPHYKIYIPSSNNK IVLSPINTAKVHTTQLYAQFYRINLNNILSIGNDDNDIELLSSTGFSVAVKNSTPRALQVARCVSTKTNNENAVANIIYR VLSGRRS
Molecular weight 37,55 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 100mM Na2HPO4, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession XP_001350658.1
Spec:Entrez GeneID 811304
Spec:SwissProtID Q8I5F6
NCBI Reference XP_001350658.1
Aliases /Synonyms PFL1260, hydrolase / phosphatase, putative
Reference PX-P1140
Note For research use only
Molecular Constructor
Full-length Yes
Product name Plasmodium falciparum PFL1260 Recombinant Protein
Uniprot ID Q8I5F6
Uniprot link http://www.uniprot.org/uniprot/Q8I5F6
Origin species Plasmodium falciparum
Expression system Prokaryotic expression
Sequence MAHNHRHKHKLMLKHKYNDSCVQELFYKNNIKLIAIDIDGTLADDTGKISDENLKAIEVCKKGGIEIILASGRLHSYAMK MFTNEQIEKYKIEKLDGVYSHGAYIHMKGYDYVYRKFSYKDLELILFSLGSYNILRNAVFLTVDSAYVINDDIKLIEEYI YTPESEGIISDIEYVKIIDTNYKPILINKIKDIFNIGDIVSIEIYDKLYPNQDIYSDLFKVLFYELQPHYKIYIPSSNNK IVLSPINTAKVHTTQLYAQFYRINLNNILSIGNDDNDIELLSSTGFSVAVKNSTPRALQVARCVSTKTNNENAVANIIYR VLSGRRS
Molecular weight 37,55 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 100mM Na2HPO4, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession XP_001350658.1
Spec:Entrez GeneID 811304
Spec:SwissProtID Q8I5F6
NCBI Reference XP_001350658.1
Aliases /Synonyms PFL1260, hydrolase / phosphatase, putative
Reference PX-P1140
Note For research use only
Molecular Constructor
Full-length Yes

There are no reviews yet.

Be the first to review “Plasmodium falciparum PFL1260 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products