Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag

Host species:
Mammalian cells
Uniprot ID:
P21860
Molecular weight:
71.67 kDa

$250.00

50ug + 250 loyalty points
Met1–Thr643 His
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag

Product name Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag
Uniprot ID P21860
Uniprot link https://www.uniprot.org/uniprot/P21860
Expression system Eukaryotic expression
Raw Antigen Sequence MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILS GGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVA SCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLI MKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQC AHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTGSHHHHHH
Molecular weight 71.67 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr643
Protein Accession P21860
Spec:Entrez GeneID 2065
Spec:NCBI Gene Aliases HER3; FERLK; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
Spec:SwissProtID Q9BUD7
NCBI Reference P21860
Aliases /Synonyms Proto-oncogene-like protein c-ErbB-3,Tyrosine kinase-type cell surface receptor HER3,HER3
Reference PX-P4724
Note For research use only
Molecular Constructor
Met1–Thr643 His
Product name Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag
Uniprot ID P21860
Uniprot link https://www.uniprot.org/uniprot/P21860
Expression system Eukaryotic expression
Raw Antigen Sequence MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILS GGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVA SCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLI MKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQC AHFRDGPHCVSSCPHGVLGAKGPIYKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTGSHHHHHH
Molecular weight 71.67 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Thr643
Protein Accession P21860
Spec:Entrez GeneID 2065
Spec:NCBI Gene Aliases HER3; FERLK; LCCS2; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3
Spec:SwissProtID Q9BUD7
NCBI Reference P21860
Aliases /Synonyms Proto-oncogene-like protein c-ErbB-3,Tyrosine kinase-type cell surface receptor HER3,HER3
Reference PX-P4724
Note For research use only
Molecular Constructor
Met1–Thr643 His

Lumretuzumab Biosimilar – Anti-ERBB3 mAb – Research Grade binds to Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag in indirect ELISA Assay

Lumretuzumab Biosimilar – Anti-ERBB3 mAb – Research Grade binds to Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag in indirect ELISA Assay

Immobilized Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag (cat. No.PX-P4724) at 0.5µg/mL (100µL/well) can bind to Lumretuzumab Biosimilar- Anti-ERBB3 mAb- Research Grade (cat. No.PX-TA1357) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

There are no reviews yet.

Be the first to review “Receptor tyrosine-protein kinase erbB-3(ERBB3)His Tag”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products