Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Anti-HLA-A2-peptide (LLLTVLTVV) Complex (M3B8)

Original price was: $444.00.Current price is: $324.00.

50ug 27% OFF + 324 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Anti-HLA-A2-peptide (LLLTVLTVV) Complex (M3B8)

Product name ARO-A15296-100
Uniprot ID P04439 & P15941
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15296
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen HLAA,Human leukocyte antigen A,HLA class I histocompatibility antigen,A alpha chain,HLA-A,PEMT,CA 15-3,H23AG,Peanut-reactive urinary mucin,PEM,EMA,Cancer antigen 15-3,MUC-1,Episialin,MUC1-CT,MUC1-beta,Tumor-associated mucin,CD227,Polymorphic epithelial mucin,KL-6,MUC1-alpha,MUC1,PUM,Krebs von den Lungen-6,MUC1-NT,Tumor-associated epithelial membrane antigen,Mucin-1,Breast carcinoma-associated antigen DF3,Carcinoma-associated mucin
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15296-1MG
Uniprot ID P04439 & P15941
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15296
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen HLAA,Human leukocyte antigen A,HLA class I histocompatibility antigen,A alpha chain,HLA-A,PEMT,CA 15-3,H23AG,Peanut-reactive urinary mucin,PEM,EMA,Cancer antigen 15-3,MUC-1,Episialin,MUC1-CT,MUC1-beta,Tumor-associated mucin,CD227,Polymorphic epithelial mucin,KL-6,MUC1-alpha,MUC1,PUM,Krebs von den Lungen-6,MUC1-NT,Tumor-associated epithelial membrane antigen,Mucin-1,Breast carcinoma-associated antigen DF3,Carcinoma-associated mucin
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15296-50
Uniprot ID P04439 & P15941
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15296
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen HLAA,Human leukocyte antigen A,HLA class I histocompatibility antigen,A alpha chain,HLA-A,PEMT,CA 15-3,H23AG,Peanut-reactive urinary mucin,PEM,EMA,Cancer antigen 15-3,MUC-1,Episialin,MUC1-CT,MUC1-beta,Tumor-associated mucin,CD227,Polymorphic epithelial mucin,KL-6,MUC1-alpha,MUC1,PUM,Krebs von den Lungen-6,MUC1-NT,Tumor-associated epithelial membrane antigen,Mucin-1,Breast carcinoma-associated antigen DF3,Carcinoma-associated mucin
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Recombinant Anti-HLA-A2-peptide (LLLTVLTVV) Complex (M3B8)

SDS-PAGE for Recombinant Anti-HLA-A2-peptide (LLLTVLTVV) Complex (M3B8)

Recombinant Anti-HLA-A2-peptide (LLLTVLTVV) Complex (M3B8), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Anti-HLA-A2-peptide (LLLTVLTVV) Complex (M3B8)

There are no reviews yet.

Be the first to review “Recombinant Anti-HLA-A2-peptide (LLLTVLTVV) Complex (M3B8)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products