Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)

Original price was: $453.00.Current price is: $324.00.

50ug 28% OFF + 324 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)
Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)

Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)

Product name ARO-A15336-100
Uniprot ID P04439 & P40967
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15336
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen HLAA,Human leukocyte antigen A,HLA class I histocompatibility antigen,A alpha chain,HLA-A,ME20M,Melanocyte protein PMEL,Silver locus protein homolog,Secreted melanoma-associated ME20 antigen,D12S53E,95 kDa melanocyte-specific secreted glycoprotein,SILV,P100,Premelanosome protein,PMEL17,ME20S,PMEL,ME20-S,ME20-M,P26,P1,Melanocytes lineage-specific antigen GP100,Melanocyte protein Pmel 17,Melanoma-associated ME20 antigen
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15336-1MG
Uniprot ID P04439 & P40967
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15336
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen HLAA,Human leukocyte antigen A,HLA class I histocompatibility antigen,A alpha chain,HLA-A,ME20M,Melanocyte protein PMEL,Silver locus protein homolog,Secreted melanoma-associated ME20 antigen,D12S53E,95 kDa melanocyte-specific secreted glycoprotein,SILV,P100,Premelanosome protein,PMEL17,ME20S,PMEL,ME20-S,ME20-M,P26,P1,Melanocytes lineage-specific antigen GP100,Melanocyte protein Pmel 17,Melanoma-associated ME20 antigen
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15336-50
Uniprot ID P04439 & P40967
Raw Antigen Sequence MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15336
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen HLAA,Human leukocyte antigen A,HLA class I histocompatibility antigen,A alpha chain,HLA-A,ME20M,Melanocyte protein PMEL,Silver locus protein homolog,Secreted melanoma-associated ME20 antigen,D12S53E,95 kDa melanocyte-specific secreted glycoprotein,SILV,P100,Premelanosome protein,PMEL17,ME20S,PMEL,ME20-S,ME20-M,P26,P1,Melanocytes lineage-specific antigen GP100,Melanocyte protein Pmel 17,Melanoma-associated ME20 antigen
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)

SDS-PAGE for Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)

Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)

There are no reviews yet.

Be the first to review “Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products