Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Bovine viral diarrhea virus/BVDV Envelope glycoprotein E2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)
Uniprot ID:
P19711
Molecular weight:
20.34 kDa

Original price was: $322.00.Current price is: $274.00.

50ug 15% OFF + 274 loyalty points
His693–Ser851
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Bovine viral diarrhea virus/BVDV Envelope glycoprotein E2 Protein, N-His

Product name ARO-P12722-100
Uniprot ID P19711
Origin species Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)
Expression system Prokaryotic expression
Raw Antigen Sequence HLDCKPEFSYAIAKDERIGQLGAEGLTTTWKEYSPGMKLEDTMVIAWCEDGKLMYLQRCTRETRYLAILHTRALPTSVVFKKLFDGRKQEDVVEMNDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRS
Molecular weight 20.34 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His693-Ser851
Aliases /Synonyms Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Reference ARO-P12722
Note For research use only.
Molecular Constructor
His693–Ser851
Product name ARO-P12722-1MG
Uniprot ID P19711
Origin species Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)
Expression system Prokaryotic expression
Raw Antigen Sequence HLDCKPEFSYAIAKDERIGQLGAEGLTTTWKEYSPGMKLEDTMVIAWCEDGKLMYLQRCTRETRYLAILHTRALPTSVVFKKLFDGRKQEDVVEMNDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRS
Molecular weight 20.34 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His693-Ser851
Aliases /Synonyms Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Reference ARO-P12722
Note For research use only.
Molecular Constructor
His693–Ser851
Product name ARO-P12722-50
Uniprot ID P19711
Origin species Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)
Expression system Prokaryotic expression
Raw Antigen Sequence HLDCKPEFSYAIAKDERIGQLGAEGLTTTWKEYSPGMKLEDTMVIAWCEDGKLMYLQRCTRETRYLAILHTRALPTSVVFKKLFDGRKQEDVVEMNDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRS
Molecular weight 20.34 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His693-Ser851
Aliases /Synonyms Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Reference ARO-P12722
Note For research use only.
Molecular Constructor
His693–Ser851

Introduction

Recombinant Bovine viral diarrhea virus (BVDV) Envelope glycoprotein E2 is a key protein that plays a crucial role in the structure and activity of the BVDV virus. BVDV is a highly contagious virus that affects cattle and other ruminants, causing a wide range of clinical symptoms including diarrhea, respiratory disease, and reproductive disorders. The development of recombinant BVDV E2 protein has been a significant breakthrough in the field of veterinary medicine, as it has enabled the production of highly effective vaccines for BVDV.

Structure of Recombinant BVDV E2 Protein

The BVDV E2 protein is a glycoprotein that is composed of 372 amino acids with a molecular weight of approximately 45 kDa. It is a type I transmembrane protein, which means that it spans the viral membrane and is present on the surface of the virus. The recombinant BVDV E2 protein is produced by cloning the gene encoding the E2 protein into a suitable expression vector, such as a bacterial or mammalian cell expression system. This allows for the production of large quantities of the protein in a pure and highly stable form.

The recombinant BVDV E2 protein contains three distinct domains: the N-terminal domain, the central domain, and the C-terminal domain. The N-terminal domain is responsible for receptor binding, while the central domain is involved in virus neutralization. The C-terminal domain is responsible for the formation of the viral envelope and is also involved in cell entry and fusion.

Activity of Recombinant BVDV E2 Protein

The main function of the BVDV E2 protein is to mediate the attachment of the virus to host cells and facilitate its entry into the cell. This process is crucial for the virus to establish infection and replicate within the host. The recombinant BVDV E2 protein is highly immunogenic, meaning that it can stimulate the production of antibodies in the host. These antibodies can bind to the E2 protein and prevent the virus from attaching to host cells, thereby neutralizing its infectivity.

In addition to its role in virus entry, the BVDV E2 protein also plays a crucial role in the pathogenesis of BVDV. It has been shown that the E2 protein is responsible for the induction of apoptosis (cell death) in infected cells, which contributes to the development of clinical symptoms in infected animals. The recombinant BVDV E2 protein can also induce a strong immune response, leading to the production of cytokines and chemokines that are important in controlling viral infections.

Application of Recombinant BVDV E2 Protein

The recombinant BVDV E2 protein has a wide range of applications in the field of veterinary medicine. The most significant application is in the development of vaccines against BVDV. The recombinant E2 protein is used as an antigen in these vaccines, which stimulates the production of neutralizing antibodies in the host. This provides protection against BVDV infection and helps to control the spread of the virus.

In addition to vaccines, the recombinant BVDV E2 protein is also used in diagnostic tests for BVDV. These tests detect the presence of antibodies against the E2 protein in the blood of infected animals, providing a quick and accurate diagnosis of BVDV infection. The recombinant E2 protein is also used in research studies to better understand the structure and function of BVDV and to develop new treatments for BVDV infection.

Conclusion

In conclusion, the recombinant BVDV E2 protein is a crucial component in the structure and activity of the BVDV virus. Its unique structure and functions make it an ideal target for the development of vaccines and diagnostic tests against BVDV. The recombinant E2 protein has revolutionized the field of veterinary medicine, providing effective tools for the prevention and control of BVDV infection in cattle and other ruminants. Further research on the

Recombinant Bovine viral diarrhea virus/BVDV Envelope glycoprotein E2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Bovine viral diarrhea virus/BVDV Envelope glycoprotein E2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products