Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Clostridium tetani (strain Massachusetts / E88)
Uniprot ID:
P04958
Molecular weight:
54.66 kDa

Original price was: $356.00.Current price is: $274.00.

50ug 23% OFF + 274 loyalty points
Met1–Ser458
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein, N-His

Product name ARO-P10832-100
Uniprot ID P04958
Origin species Clostridium tetani (strain Massachusetts / E88)
Expression system Prokaryotic expression
Raw Antigen Sequence MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTAS
Molecular weight 54.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser458
Aliases /Synonyms Tetanus toxin, 3.4.24.68, Tentoxylysin, Tetanus toxin light chain, Tetanus toxin chain L, Tetanus toxin heavy chain, Tetanus toxin chain H, tetX, CTC_p60, Clostridium tetani (strain Massachusetts / E88)
Reference ARO-P10832
Note For research use only.
Molecular Constructor
Met1–Ser458
Product name ARO-P10832-1MG
Uniprot ID P04958
Origin species Clostridium tetani (strain Massachusetts / E88)
Expression system Prokaryotic expression
Raw Antigen Sequence MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTAS
Molecular weight 54.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser458
Aliases /Synonyms Tetanus toxin, 3.4.24.68, Tentoxylysin, Tetanus toxin light chain, Tetanus toxin chain L, Tetanus toxin heavy chain, Tetanus toxin chain H, tetX, CTC_p60, Clostridium tetani (strain Massachusetts / E88)
Reference ARO-P10832
Note For research use only.
Molecular Constructor
Met1–Ser458
Product name ARO-P10832-50
Uniprot ID P04958
Origin species Clostridium tetani (strain Massachusetts / E88)
Expression system Prokaryotic expression
Raw Antigen Sequence MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFNPPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGNSYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTAS
Molecular weight 54.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser458
Aliases /Synonyms Tetanus toxin, 3.4.24.68, Tentoxylysin, Tetanus toxin light chain, Tetanus toxin chain L, Tetanus toxin heavy chain, Tetanus toxin chain H, tetX, CTC_p60, Clostridium tetani (strain Massachusetts / E88)
Reference ARO-P10832
Note For research use only.
Molecular Constructor
Met1–Ser458

Introduction to Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein

Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT protein is a genetically engineered protein that is derived from the bacteria Clostridium tetani, the causative agent of tetanus. This protein is a potent neurotoxin that is responsible for the severe symptoms of tetanus, including muscle stiffness and spasms. The recombinant version of this protein has been extensively studied and has shown promising results in various applications, including vaccine development and therapeutic use.

Structure of Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein

The recombinant Clostridium tetani tetX/Tetanus toxin/TeNT protein is a large molecule with a molecular weight of approximately 150 kDa. It is composed of a heavy chain (Hc) and a light chain (Lc) that are connected by a disulfide bond. The heavy chain is responsible for binding to specific receptors on nerve cells, while the light chain is responsible for the toxin’s enzymatic activity.

The Hc of the recombinant protein is composed of two domains, the C-terminal domain (Hc-C) and the N-terminal domain (Hc-N). The Hc-C domain is responsible for binding to the neuronal membrane, while the Hc-N domain is involved in receptor binding and internalization. The Lc of the recombinant protein is composed of a single domain that possesses the enzymatic activity responsible for cleaving specific proteins involved in neurotransmission.

Activity of Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein

The recombinant Clostridium tetani tetX/Tetanus toxin/TeNT protein is a potent neurotoxin that acts by blocking the release of inhibitory neurotransmitters, such as glycine and GABA, from nerve cells. This results in uncontrolled muscle contractions and spasms, which are characteristic symptoms of tetanus. The enzymatic activity of the Lc of the protein is responsible for cleaving specific proteins involved in the release of these neurotransmitters, leading to their inhibition.

Besides its neurotoxic activity, the recombinant protein also has immunogenic properties. It can elicit a strong immune response in the host, leading to the production of antibodies against the toxin. This makes it an excellent candidate for vaccine development against tetanus.

Application of Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein

Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT protein has several applications, including vaccine development and therapeutic use.

Vaccine Development

The recombinant protein has been extensively studied as a potential vaccine candidate against tetanus. It has been shown to elicit a strong immune response in animal models, leading to the production of neutralizing antibodies against the toxin. This makes it a promising candidate for the development of a safe and effective vaccine against tetanus.

In addition, the recombinant protein can be used as a carrier protein for other antigens, making it a potential candidate for the development of multivalent vaccines against other diseases.

Therapeutic Use

The recombinant protein has also shown potential for therapeutic use in the treatment of tetanus. It can be used as a passive immunotherapy, where the recombinant protein is administered to individuals who have already been exposed to the tetanus toxin. This can help neutralize the toxin and prevent its harmful effects.

In addition, the recombinant protein can be used as an adjuvant in cancer therapy. Studies have shown that the toxin can target and kill specific cancer cells, making it a potential candidate for targeted cancer therapy.

Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Clostridium tetani tetX/Tetanus toxin/TeNT Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products