Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Flag tag Control Protein

Host species:
Escherichia coli (E.coli)
Origin species:
General
Uniprot ID:
P03772
Molecular weight:
27.32 kDa

Original price was: $482.00.Current price is: $392.00.

100ug 19% OFF + 392 loyalty points
Met1–Ala221
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Flag tag Control Protein

Product name ARO-P12696-100
Uniprot ID P03772
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
Molecular weight 27.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala221
Aliases /Synonyms Flag tag Control Protein, Flag tag Protein
Reference ARO-P12696
Note For research use only.
Molecular Constructor
Met1–Ala221
Product name ARO-P12696-1MG
Uniprot ID P03772
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
Molecular weight 27.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala221
Aliases /Synonyms Flag tag Control Protein, Flag tag Protein
Reference ARO-P12696
Note For research use only.
Molecular Constructor
Met1–Ala221
Product name ARO-P12696-50
Uniprot ID P03772
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
Molecular weight 27.32 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala221
Aliases /Synonyms Flag tag Control Protein, Flag tag Protein
Reference ARO-P12696
Note For research use only.
Molecular Constructor
Met1–Ala221

Introduction

Recombinant Flag tag Control Protein, also known as Flag-tagged protein, is a widely used tool in the field of biotechnology and life sciences. It is a fusion protein consisting of a short amino acid sequence, known as the Flag tag, attached to a target protein. The Flag tag is a peptide sequence derived from the protein, FLAG, and is specifically recognized by an antibody called the anti-Flag antibody. This allows for easy detection, purification, and manipulation of the target protein, making it an essential tool for both therapeutic target and research use.

Structure of Recombinant Flag tag Control Protein

The structure of Recombinant Flag tag Control Protein consists of two main components: the Flag tag and the target protein. The Flag tag is a small peptide sequence of eight amino acids (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys) that is fused to the N- or C-terminus of the target protein. This fusion is achieved through genetic engineering techniques, where the DNA sequence encoding the Flag tag is inserted into the gene encoding the target protein. The resulting fusion protein retains the biological activity of the target protein, while also gaining the properties of the Flag tag.

Activity of Recombinant Flag tag Control Protein

The Flag tag is a powerful tool for the detection, purification, and manipulation of proteins. The anti-Flag antibody specifically recognizes and binds to the Flag tag, allowing for easy detection of the fusion protein in various assays, such as Western blotting and immunofluorescence. This eliminates the need for specific antibodies for each individual target protein, making it a cost-effective and efficient method for protein detection.
In addition, the Flag tag can also be used for purification of the fusion protein. The anti-Flag antibody can be coupled to a solid support, such as agarose beads, and used to purify the fusion protein from a complex mixture. This is especially useful for large-scale production of recombinant proteins for therapeutic purposes.
Moreover, the Flag tag can also be used for manipulation of the target protein. By introducing specific mutations in the Flag tag sequence, the properties of the fusion protein can be altered. For example, the Flag tag can be modified to allow for site-specific labeling of the fusion protein, which is useful for studying protein-protein interactions and protein localization.

Application of Recombinant Flag tag Control Protein

The versatility of Recombinant Flag tag Control Protein makes it a valuable tool for both therapeutic target and research use. In the field of therapeutics, the Flag tag can be used for the production and purification of recombinant proteins for therapeutic purposes. This includes the production of therapeutic enzymes, hormones, and antibodies. The Flag tag allows for efficient purification of the fusion protein, ensuring high purity and activity of the final product.
In research, Recombinant Flag tag Control Protein is widely used for studying protein structure, function, and interactions. The Flag tag can be used to label and track proteins in live cells, allowing for visualization of protein dynamics and localization. It is also commonly used in protein-protein interaction studies, where the Flag tag is fused to both interacting proteins, allowing for their detection and analysis.

Conclusion

In conclusion, Recombinant Flag tag Control Protein is a versatile tool that has revolutionized the field of biotechnology and life sciences. Its simple structure, powerful activity, and wide range of applications make it an essential tool for both therapeutic target and research use.

SDS-PAGE for Recombinant Flag tag Control Protein

SDS-PAGE for Recombinant Flag tag Control Protein

Recombinant Flag tag Control Protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Flag tag Control Protein

There are no reviews yet.

Be the first to review “Recombinant Flag tag Control Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products