Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MYL6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P60660
Molecular weight:
18.38 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
His Phe4–Arg146
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MYL6 Protein, N-His

Product name ARO-P15043-100
Uniprot ID P60660
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVR
Molecular weight 18.38 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe4-Arg146
Aliases /Synonyms MLC-3, MYL6, Myosin light polypeptide 6, Myosin light chain 3, 17 kDa myosin light chain, Myosin light chain A3, LC17, Myosin light chain alkali 3, Smooth muscle and nonmuscle myosin light chain alkali 6
Reference ARO-P15043
Note For research use only.
Molecular Constructor
His Phe4–Arg146
Product name ARO-P15043-1MG
Uniprot ID P60660
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVR
Molecular weight 18.38 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe4-Arg146
Aliases /Synonyms MLC-3, MYL6, Myosin light polypeptide 6, Myosin light chain 3, 17 kDa myosin light chain, Myosin light chain A3, LC17, Myosin light chain alkali 3, Smooth muscle and nonmuscle myosin light chain alkali 6
Reference ARO-P15043
Note For research use only.
Molecular Constructor
His Phe4–Arg146
Product name ARO-P15043-50
Uniprot ID P60660
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVR
Molecular weight 18.38 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe4-Arg146
Aliases /Synonyms MLC-3, MYL6, Myosin light polypeptide 6, Myosin light chain 3, 17 kDa myosin light chain, Myosin light chain A3, LC17, Myosin light chain alkali 3, Smooth muscle and nonmuscle myosin light chain alkali 6
Reference ARO-P15043
Note For research use only.
Molecular Constructor
His Phe4–Arg146

There are no reviews yet.

Be the first to review “Recombinant Human MYL6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products