Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant DENV-1 Envelope protein E, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Dengue virus type 1 (strain Nauru/West Pac/1974) (DENV-1)
Uniprot ID:
P17763
Molecular weight:
13.40 kDa

Original price was: $318.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Met577–Lys680
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant DENV-1 Envelope protein E, N-His

Product name ARO-P12712-100
Uniprot ID P17763
Origin species Dengue virus type 1 (strain Nauru/West Pac/1974) (DENV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGK
Molecular weight 13.40 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met577-Lys680
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12712
Note For research use only.
Molecular Constructor
Met577–Lys680
Product name ARO-P12712-1MG
Uniprot ID P17763
Origin species Dengue virus type 1 (strain Nauru/West Pac/1974) (DENV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGK
Molecular weight 13.40 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met577-Lys680
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12712
Note For research use only.
Molecular Constructor
Met577–Lys680
Product name ARO-P12712-50
Uniprot ID P17763
Origin species Dengue virus type 1 (strain Nauru/West Pac/1974) (DENV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGK
Molecular weight 13.40 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met577-Lys680
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12712
Note For research use only.
Molecular Constructor
Met577–Lys680

Introduction

Recombinant DENV-1 Envelope protein E, also known as recombinant protein E or DENV-1 E protein, is a key component of the Dengue virus (DENV). It is a highly conserved protein that is essential for the virus to enter and infect host cells. Recombinant DENV-1 E protein is produced through genetic engineering techniques, making it a valuable tool for research and development of vaccines and diagnostic tests for Dengue virus.

Structure of Recombinant DENV-1 Envelope protein E

The DENV-1 E protein is a glycoprotein that is composed of 495 amino acids. It is a type I transmembrane protein, meaning that it spans the viral membrane and has a portion exposed on the outer surface of the virus. The protein is divided into three domains: domain I, II, and III. Domain I and II are located on the outer surface of the virus and are involved in receptor binding, while domain III is buried within the viral membrane and is responsible for membrane fusion during viral entry.

Recombinant DENV-1 E protein is produced by inserting the gene encoding for the protein into a host cell, such as bacteria or yeast. The protein is then expressed and purified, resulting in a highly pure and stable form of the protein that can be used for various applications.

Activity of Recombinant DENV-1 Envelope protein E

The main function of DENV-1 E protein is to mediate the attachment and entry of the virus into host cells. This is achieved through its interaction with specific receptors on the surface of host cells, such as heparan sulfate and DC-SIGN. The protein also plays a role in viral replication and assembly.

Recombinant DENV-1 E protein has been extensively studied for its ability to induce neutralizing antibodies, which are crucial for protection against Dengue virus infection. Studies have shown that the protein can induce a strong immune response and elicit high levels of neutralizing antibodies in animal models and human subjects.

Application of Recombinant DENV-1 Envelope protein E

Recombinant DENV-1 E protein has a wide range of applications in the field of Dengue virus research and development. One of its key applications is in the development of vaccines against Dengue virus. The protein can be used as a vaccine antigen, either alone or in combination with other viral proteins, to induce a protective immune response against the virus. Several clinical trials have been conducted using recombinant DENV-1 E protein as a vaccine candidate, with promising results.

Another important application of recombinant DENV-1 E protein is in the development of diagnostic tests for Dengue virus. The protein can be used as an antigen in serological tests, such as ELISA and lateral flow assays, to detect the presence of antibodies against the virus in patient samples. This is crucial for accurate diagnosis and surveillance of Dengue virus infections.

Furthermore, recombinant DENV-1 E protein is also used in basic research to study the structure, function, and interactions of the protein with host cells and other viral proteins. It is also a valuable tool for the development of antiviral drugs that target the protein and inhibit its activity.

Conclusion

Recombinant DENV-1 Envelope protein E is a crucial component of the Dengue virus and has a variety of important roles in viral entry, replication, and immune response. Its production through genetic engineering techniques has made it a valuable tool for research and development of vaccines and diagnostic tests for Dengue virus. With ongoing research and development, recombinant DENV-1 E protein holds great promise for the prevention and control of Dengue virus infections.

Recombinant DENV-1 Envelope protein E, N-His

There are no reviews yet.

Be the first to review “Recombinant DENV-1 Envelope protein E, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products