Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human LBR Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14739
Molecular weight:
34.50 kDa

Original price was: $470.00.Current price is: $392.00.

100ug 17% OFF + 392 loyalty points
Ala7–Arg61
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human LBR Protein, N-GST & C-His

Product name ARO-P11390-100
Uniprot ID Q14739
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFR
Molecular weight 34.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala7-Arg61
Aliases /Synonyms LMN2R, LBR, C14SR, Integral nuclear envelope inner membrane protein, Sterol C14-reductase, 3-beta-hydroxysterol Delta (14)-reductase, Delta(14)-sterol reductase LBR, Lamin-B receptor, Delta-14-SR, C-14 sterol reductase
Reference ARO-P11390
Note For research use only.
Molecular Constructor
Ala7–Arg61
Product name ARO-P11390-1MG
Uniprot ID Q14739
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFR
Molecular weight 34.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala7-Arg61
Aliases /Synonyms LMN2R, LBR, C14SR, Integral nuclear envelope inner membrane protein, Sterol C14-reductase, 3-beta-hydroxysterol Delta (14)-reductase, Delta(14)-sterol reductase LBR, Lamin-B receptor, Delta-14-SR, C-14 sterol reductase
Reference ARO-P11390
Note For research use only.
Molecular Constructor
Ala7–Arg61
Product name ARO-P11390-50
Uniprot ID Q14739
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFR
Molecular weight 34.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala7-Arg61
Aliases /Synonyms LMN2R, LBR, C14SR, Integral nuclear envelope inner membrane protein, Sterol C14-reductase, 3-beta-hydroxysterol Delta (14)-reductase, Delta(14)-sterol reductase LBR, Lamin-B receptor, Delta-14-SR, C-14 sterol reductase
Reference ARO-P11390
Note For research use only.
Molecular Constructor
Ala7–Arg61

SDS-PAGE for Recombinant Human LBR Protein, N-GST & C-His

SDS-PAGE for Recombinant Human LBR Protein, N-GST & C-His

Recombinant Human LBR Protein, N-GST & C-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Human LBR Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human LBR Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products