Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NUMA1/NMP-22 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14980
Molecular weight:
19.76 kDa

Original price was: $339.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Met1–Lys153
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NUMA1/NMP-22 Protein, N-His

Product name ARO-P12755-100
Uniprot ID Q14980
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQK
Molecular weight 19.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys153
Aliases /Synonyms SP-H antigen, NMP-22, Nuclear matrix protein-22, NMP22, NuMA protein, Nuclear mitotic apparatus protein, NUMA, Nuclear mitotic apparatus protein 1, NUMA1
Reference ARO-P12755
Note For research use only.
Molecular Constructor
Met1–Lys153
Product name ARO-P12755-1MG
Uniprot ID Q14980
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQK
Molecular weight 19.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys153
Aliases /Synonyms SP-H antigen, NMP-22, Nuclear matrix protein-22, NMP22, NuMA protein, Nuclear mitotic apparatus protein, NUMA, Nuclear mitotic apparatus protein 1, NUMA1
Reference ARO-P12755
Note For research use only.
Molecular Constructor
Met1–Lys153
Product name ARO-P12755-50
Uniprot ID Q14980
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQK
Molecular weight 19.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys153
Aliases /Synonyms SP-H antigen, NMP-22, Nuclear matrix protein-22, NMP22, NuMA protein, Nuclear mitotic apparatus protein, NUMA, Nuclear mitotic apparatus protein 1, NUMA1
Reference ARO-P12755
Note For research use only.
Molecular Constructor
Met1–Lys153

Introduction

Recombinant Human NUMA1/NMP-22 Protein is a highly versatile and important protein used in various scientific fields. This protein is a recombinant form of the human NUMA1 protein, also known as Nuclear Mitotic Apparatus protein 1, and is also referred to as NMP-22. In this article, we will explore the structure, activity, and application of this protein in detail.

Structure of Recombinant Human NUMA1/NMP-22 Protein

The Recombinant Human NUMA1/NMP-22 Protein is a 116 kDa protein that consists of 1050 amino acids. It is encoded by the NUMA1 gene, located on chromosome 11 in humans. The protein contains multiple domains, including a coiled-coil domain, a nuclear localization signal, and a microtubule binding domain. These domains play a crucial role in the protein’s function and activity.

Activity of Recombinant Human NUMA1/NMP-22 Protein

The main function of Recombinant Human NUMA1/NMP-22 Protein is to regulate the organization and dynamics of microtubules. Microtubules are essential components of the cell’s cytoskeleton and are involved in various cellular processes, including cell division, cell movement, and intracellular transport. The protein binds to microtubules and helps in their organization, stability, and movement.

Apart from its role in microtubule regulation, Recombinant Human NUMA1/NMP-22 Protein also plays a crucial role in cell division. It is involved in the formation and maintenance of the mitotic spindle, a structure that helps in the proper segregation of chromosomes during cell division. The protein is also essential for the formation of the centrosome, a cellular organelle that serves as the main microtubule organizing center in animal cells.

Application of Recombinant Human NUMA1/NMP-22 Protein

Recombinant Human NUMA1/NMP-22 Protein has various applications in the field of cell biology and medicine. Some of the key applications of this protein are:

1. Cancer Research: The overexpression of NUMA1 has been observed in various types of cancer, including breast, lung, and colorectal cancer. Recombinant Human NUMA1/NMP-22 Protein is used in cancer research to study its role in tumorigenesis and to develop targeted therapies.

2. Cell Division Studies: Recombinant Human NUMA1/NMP-22 Protein is a crucial component of the mitotic spindle and is essential for proper cell division. It is used in cell biology studies to understand the mechanisms of cell division and the role of microtubules in this process.

3. Diagnostic Marker for Bladder Cancer: NMP-22 is a well-known biomarker for bladder cancer. Recombinant Human NUMA1/NMP-22 Protein is used in diagnostic tests to detect the presence of NMP-22 in urine samples, which can indicate the presence of bladder cancer.

4. Drug Development: The microtubule-binding domain of Recombinant Human NUMA1/NMP-22 Protein has been identified as a potential target for anti-cancer drugs. Researchers are studying the protein’s structure and function to develop drugs that can specifically target and inhibit its activity.

5. Gene Therapy: The NUMA1 gene has been implicated in various genetic disorders, including microcephaly and schizophrenia. Recombinant Human NUMA1/NMP-22 Protein is used in gene therapy studies to understand the role of this gene in these disorders and to develop potential treatments.

Conclusion

Recombinant Human NUMA1/NMP-22 Protein is a highly versatile protein with various important functions in the cell. Its role in microtubule regulation and cell division makes it a crucial protein in various scientific fields, including cancer research, cell biology, and medicine. With ongoing research and advancements in protein engineering, the potential applications of this protein are continually expanding, making it a valuable tool in the scientific community.

Recombinant Human NUMA1/NMP-22 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NUMA1/NMP-22 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products