Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Recombinant Human TRIM28 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q13263
Molecular weight:
22.60 kDa

Original price was: $419.00.Current price is: $327.00.

100ug 22% OFF + 327 loyalty points
Ser50–Arg136
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Recombinant Human TRIM28 Protein, N-His-SUMO & C-Strep

Recombinant Human TRIM28 Protein, N-His-SUMO & C-Strep

Product name ARO-P12371-100
Uniprot ID Q13263
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPAGGGAEALELLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCKQQCFSKDIVENYFMR
Molecular weight 22.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Arg136
Aliases /Synonyms TIF1-beta, Tripartite motif-containing protein 28, KRAB-associated protein 1, TRIM28, RING-type E3 ubiquitin transferase TIF1-beta, KRAB-interacting protein 1, KRIP-1, E3 SUMO-protein ligase TRIM28, RNF96, Nuclear corepressor KAP-1, TIF1B, Transcription intermediary factor 1-beta, KAP1, KAP-1, RING finger protein 96
Reference ARO-P12371
Note For research use only.
Molecular Constructor
Ser50–Arg136
Product name ARO-P12371-1MG
Uniprot ID Q13263
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPAGGGAEALELLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCKQQCFSKDIVENYFMR
Molecular weight 22.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Arg136
Aliases /Synonyms TIF1-beta, Tripartite motif-containing protein 28, KRAB-associated protein 1, TRIM28, RING-type E3 ubiquitin transferase TIF1-beta, KRAB-interacting protein 1, KRIP-1, E3 SUMO-protein ligase TRIM28, RNF96, Nuclear corepressor KAP-1, TIF1B, Transcription intermediary factor 1-beta, KAP1, KAP-1, RING finger protein 96
Reference ARO-P12371
Note For research use only.
Molecular Constructor
Ser50–Arg136
Product name ARO-P12371-50
Uniprot ID Q13263
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPAGGGAEALELLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCKQQCFSKDIVENYFMR
Molecular weight 22.60 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser50-Arg136
Aliases /Synonyms TIF1-beta, Tripartite motif-containing protein 28, KRAB-associated protein 1, TRIM28, RING-type E3 ubiquitin transferase TIF1-beta, KRAB-interacting protein 1, KRIP-1, E3 SUMO-protein ligase TRIM28, RNF96, Nuclear corepressor KAP-1, TIF1B, Transcription intermediary factor 1-beta, KAP1, KAP-1, RING finger protein 96
Reference ARO-P12371
Note For research use only.
Molecular Constructor
Ser50–Arg136

Recombinant Human TRIM28 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human TRIM28 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products