Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRPM7/LTRPC7 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96QT4
Molecular weight:
39.70 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Gly93–Gly431
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRPM7/LTRPC7 Protein, N-His

Product name ARO-P11512-100
Uniprot ID Q96QT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVINFQGGSHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQNEALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRVDIAKNHVFVYG
Molecular weight 39.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly93-Gly431
Aliases /Synonyms LTrpC7, LTRPC7, LTrpC-7, TRPM7, Transient receptor potential cation channel subfamily M member 7, CHAK1, Long transient receptor potential channel 7, Channel-kinase 1
Reference ARO-P11512
Note For research use only.
Molecular Constructor
Gly93–Gly431
Product name ARO-P11512-1MG
Uniprot ID Q96QT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVINFQGGSHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQNEALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRVDIAKNHVFVYG
Molecular weight 39.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly93-Gly431
Aliases /Synonyms LTrpC7, LTRPC7, LTrpC-7, TRPM7, Transient receptor potential cation channel subfamily M member 7, CHAK1, Long transient receptor potential channel 7, Channel-kinase 1
Reference ARO-P11512
Note For research use only.
Molecular Constructor
Gly93–Gly431
Product name ARO-P11512-50
Uniprot ID Q96QT4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVINFQGGSHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQNEALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRVDIAKNHVFVYG
Molecular weight 39.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly93-Gly431
Aliases /Synonyms LTrpC7, LTRPC7, LTrpC-7, TRPM7, Transient receptor potential cation channel subfamily M member 7, CHAK1, Long transient receptor potential channel 7, Channel-kinase 1
Reference ARO-P11512
Note For research use only.
Molecular Constructor
Gly93–Gly431

Introduction

The Recombinant Human TRPM7/LTRPC7 Protein is a highly sought-after protein in the field of molecular biology and biochemistry. It is a synthetic version of the human TRPM7/LTRPC7 protein, which is a member of the transient receptor potential (TRP) family of ion channels. This protein is involved in a variety of cellular functions, including cell proliferation, migration, and survival. In this article, we will discuss the structure, activity, and applications of this important recombinant protein.

Structure of Recombinant Human TRPM7/LTRPC7 Protein

The recombinant human TRPM7/LTRPC7 protein is a large protein with a molecular weight of approximately 200 kDa. It is composed of two main domains – an N-terminal cytoplasmic domain and a C-terminal transmembrane domain. The N-terminal domain contains several functional motifs, including a kinase domain and a coiled-coil domain, while the transmembrane domain is responsible for the ion channel activity of the protein.

The recombinant protein is produced using recombinant DNA technology, where the gene for TRPM7/LTRPC7 is inserted into a host organism, such as bacteria or mammalian cells. This allows for the large-scale production of the protein in a controlled and efficient manner.

Activity of Recombinant Human TRPM7/LTRPC7 Protein

The main activity of the recombinant human TRPM7/LTRPC7 protein is its role as an ion channel. This protein forms a non-selective cation channel that allows the passage of various ions, including calcium, magnesium, and zinc. The activity of this ion channel is crucial for maintaining cellular homeostasis and regulating various cellular processes.

In addition to its ion channel activity, the recombinant protein also has kinase activity, which is important for regulating cell signaling pathways. This activity is mediated by the kinase domain in the N-terminal region of the protein.

Applications of Recombinant Human TRPM7/LTRPC7 Protein

The recombinant human TRPM7/LTRPC7 protein has a wide range of applications in both research and therapeutic settings. Some of the key applications include:

  • Functional studies: The recombinant protein is commonly used in functional studies to understand the role of TRPM7/LTRPC7 in various cellular processes. By manipulating the expression or activity of the protein, researchers can gain insights into its function and potential therapeutic targets.
  • Drug discovery: The ion channel activity of TRPM7/LTRPC7 makes it an attractive target for drug discovery. Researchers can use the recombinant protein to screen for potential inhibitors or activators of the protein, which can then be further developed into therapeutic drugs.
  • Diagnostic tool: The recombinant protein can also be used as a diagnostic tool in certain diseases. For example, mutations in the TRPM7 gene have been linked to certain neurological disorders, and the recombinant protein can be used to detect these mutations and aid in diagnosis.
  • Vaccine development: The recombinant protein has also been used as an antigen in vaccine development. By stimulating the immune system to produce antibodies against TRPM7/LTRPC7, researchers hope to develop a vaccine that can prevent or treat certain diseases associated with this protein.

Conclusion

The Recombinant Human TRPM7/LTRPC7 Protein is a versatile and important protein in the field of molecular biology and bio

Recombinant Human TRPM7/LTRPC7 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRPM7/LTRPC7 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products