Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human F8/Coagulation factor VIII Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P00451
Molecular weight:
26 kDa

Original price was: $264.00.Current price is: $224.00.

50ug 15% OFF + 224 loyalty points
Val2144–Tyr2351
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human F8/Coagulation factor VIII Protein, N-His

Product name ARO-P10840-100
Uniprot ID P00451
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Molecular weight 26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2144-Tyr2351
Aliases /Synonyms Coagulation factor VIII, Antihemophilic factor, AHF, Procoagulant component, Factor VIIIa heavy chain, 200 kDa isoform, Factor VIIIa heavy chain, 92 kDa isoform, Factor VIII B chain, Factor VIIIa light chain, F8, F8C
Reference ARO-P10840
Note For research use only.
Molecular Constructor
Val2144–Tyr2351
Product name ARO-P10840-1MG
Uniprot ID P00451
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Molecular weight 26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2144-Tyr2351
Aliases /Synonyms Coagulation factor VIII, Antihemophilic factor, AHF, Procoagulant component, Factor VIIIa heavy chain, 200 kDa isoform, Factor VIIIa heavy chain, 92 kDa isoform, Factor VIII B chain, Factor VIIIa light chain, F8, F8C
Reference ARO-P10840
Note For research use only.
Molecular Constructor
Val2144–Tyr2351
Product name ARO-P10840-50
Uniprot ID P00451
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY
Molecular weight 26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2144-Tyr2351
Aliases /Synonyms Coagulation factor VIII, Antihemophilic factor, AHF, Procoagulant component, Factor VIIIa heavy chain, 200 kDa isoform, Factor VIIIa heavy chain, 92 kDa isoform, Factor VIII B chain, Factor VIIIa light chain, F8, F8C
Reference ARO-P10840
Note For research use only.
Molecular Constructor
Val2144–Tyr2351

Introduction

Recombinant Human F8/Coagulation factor VIII Protein, N-His (rF8/N-His) is a genetically engineered form of the human coagulation factor VIII protein, which plays a crucial role in the blood clotting process. This protein is primarily produced in the liver and is responsible for the formation of blood clots to stop bleeding. However, mutations in the gene encoding for factor VIII can result in a deficiency of this protein, leading to a bleeding disorder known as hemophilia A. rF8/N-His has been developed as a therapeutic target for the treatment of hemophilia A and is also widely used in research studies to understand the structure and function of factor VIII.

Structure of rF8/N-His

rF8/N-His is a glycoprotein consisting of 2332 amino acids with a molecular weight of approximately 300 kDa. It is composed of six domains, A1-A2-B-A3-C1-C2, with the A domains being responsible for binding to von Willebrand factor and the C domains being involved in binding to phospholipids on the surface of platelets. rF8/N-His also contains a unique N-terminal histidine tag, which allows for purification of the protein using affinity chromatography.

Activity of rF8/N-His

The primary function of rF8/N-His is to act as a cofactor for factor IXa in the blood clotting cascade. When a blood vessel is damaged, factor VIII is activated by thrombin and forms a complex with factor IXa, which then activates factor X to form thrombin. Thrombin converts fibrinogen into fibrin, which forms a mesh to stop bleeding. rF8/N-His has been shown to have similar activity to the native human factor VIII, making it an effective replacement therapy for individuals with hemophilia A.

Application as a Therapeutic Target

Hemophilia A is a genetic disorder caused by mutations in the gene encoding for factor VIII. Individuals with this condition have low levels of factor VIII or a non-functional form of the protein, leading to excessive bleeding. rF8/N-His has been developed as a therapeutic target for the treatment of hemophilia A. It is produced using recombinant DNA technology, making it free from potential contaminants found in plasma-derived factor VIII products. This reduces the risk of adverse reactions and the transmission of blood-borne diseases. rF8/N-His is administered intravenously to individuals with hemophilia A to replace the deficient or defective factor VIII and restore normal blood clotting function.

Research Use of rF8/N-His

Due to its high purity and similarity to native factor VIII, rF8/N-His is also widely used in research studies to understand the structure and function of this important protein. It has been used in crystallography studies to determine the three-dimensional structure of factor VIII and its interactions with other proteins and molecules involved in the blood clotting process. rF8/N-His has also been used in in vitro assays to study the activity of factor VIII and its response to various mutations and inhibitors.

Conclusion

Recombinant Human F8/Coagulation factor VIII Protein, N-His is a crucial protein in the blood clotting process and is essential for individuals with hemophilia A. It is produced using recombinant DNA technology and is used as a therapeutic target for the treatment of hemophilia A. rF8/N-His is also widely used in research studies to understand the structure and function of factor VIII. Its high purity and similarity to native factor VIII make it a valuable tool in the study of this important protein.

Recombinant Human F8/Coagulation factor VIII Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human F8/Coagulation factor VIII Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products